9QJY: GABA-A receptor a2b3g2 + a2NB04(silent) + GABA
GABA-A receptor a2b3g2 + a2NB04(silent) + GABA. Determined by electron microscopy at 2.78 Å resolution. Released 26 Aug 2026.
- Method
- Electron microscopy
- Resolution
- 2.78 Å
- Organisms
- Homo sapiens, Lama glama
- Chains
- 7
- Atoms
- 15,831
- Mol. weight
- 263.07 kDa
- Ligands
- ABU, NAG
- Released
- 26 Aug 2026
Explore 9QJY in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9QJY contains 55 α-helices and 104 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 9 helices, 18 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-21 | 10 | |
| β-strand | 38-48 | 11 | 1 |
| β-strand | 49 | 1 | 2 |
| β-strand | 52-53 | 2 | 1 |
| β-strand | 58-70 | 13 | 1 |
| β-strand | 82-85 | 4 | 1 |
| α-helix | 87-92 | 6 | |
| β-strand | 98-100 | 3 | 3 |
| β-strand | 103 | 1 | 1 |
| β-strand | 107-108 | 2 | 1 |
| β-strand | 112 | 1 | 4 |
| β-strand | 116 | 1 | 1 |
| β-strand | 118-121 | 4 | 1 |
| β-strand | 125-137 | 13 | 1 |
| α-helix | 142-144 | 3 | |
| β-strand | 149-158 | 10 | 3 |
| β-strand | 166-170 | 5 | 1 |
| β-strand | 178-180 | 3 | 1 |
| β-strand | 185 | 1 | 2 |
| β-strand | 190-203 | 14 | 3 |
| β-strand | 208-220 | 13 | 3 |
| α-helix | 224-227 | 4 | |
| α-helix | 230-242 | 13 | |
| α-helix | 243-245 | 3 | |
| α-helix | 251-273 | 23 | |
| α-helix | 284-312 | 29 | |
| α-helix | 314-411 | 29 | |
Chain B: 11 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-20 | 12 | |
| α-helix | 35 | 1 | |
| β-strand | 36-51 | 16 | 5 |
| β-strand | 56-68 | 13 | 5 |
| α-helix | 70-72 | 3 | |
| β-strand | 81-83 | 3 | 5 |
| α-helix | 85-90 | 6 | |
| β-strand | 96-98 | 3 | 4 |
| β-strand | 101-106 | 6 | 5 |
| β-strand | 110 | 1 | 6 |
| β-strand | 114-118 | 5 | 5 |
| β-strand | 123-135 | 13 | 5 |
| β-strand | 147-156 | 10 | 4 |
| β-strand | 164-168 | 5 | 5 |
| α-helix | 171-173 | 3 | |
| β-strand | 175-176 | 2 | 5 |
| β-strand | 186-200 | 15 | 4 |
| β-strand | 203-216 | 14 | 4 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-241 | 15 | |
| α-helix | 247-269 | 23 | |
| α-helix | 280-306 | 27 | |
| α-helix | 422-446 | 25 | |
Chain C: 9 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-35 | 10 | |
| β-strand | 51-56 | 6 | 7 |
| β-strand | 59-66 | 8 | 7 |
| β-strand | 71-83 | 13 | 7 |
| α-helix | 85-87 | 3 | |
| β-strand | 95-98 | 4 | 7 |
| α-helix | 102-105 | 4 | |
| β-strand | 111-113 | 3 | 6 |
| β-strand | 116-121 | 6 | 7 |
| β-strand | 125 | 1 | 8 |
| β-strand | 129-134 | 6 | 7 |
| β-strand | 138-150 | 13 | 7 |
| β-strand | 162-171 | 10 | 6 |
| β-strand | 179-183 | 5 | 7 |
| β-strand | 201-214 | 14 | 6 |
| β-strand | 219-231 | 13 | 6 |
| α-helix | 234-236 | 3 | |
| α-helix | 237-241 | 5 | |
| α-helix | 242-256 | 15 | |
| α-helix | 262-286 | 25 | |
| α-helix | 295-321 | 27 | |
| α-helix | 410-432 | 23 | |
Chain D: 10 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-21 | 11 | |
| β-strand | 38-48 | 11 | 9 |
| β-strand | 49 | 1 | 10 |
| β-strand | 52-53 | 2 | 11 |
| β-strand | 58-59 | 2 | 11 |
| β-strand | 61-70 | 10 | 9 |
| α-helix | 72-74 | 3 | |
| β-strand | 82-85 | 4 | 9 |
| α-helix | 87-92 | 6 | |
| β-strand | 98-100 | 3 | 8 |
| β-strand | 103 | 1 | 12 |
| β-strand | 107-108 | 2 | 9 |
| β-strand | 116 | 1 | 9 |
| β-strand | 118-121 | 4 | 9 |
| β-strand | 125-134 | 10 | 9 |
| β-strand | 136 | 1 | 12 |
| β-strand | 137 | 1 | 11 |
| α-helix | 142-144 | 3 | |
| β-strand | 149-158 | 10 | 8 |
| β-strand | 166-170 | 5 | 9 |
| β-strand | 178-180 | 3 | 9 |
| β-strand | 185 | 1 | 10 |
| β-strand | 190-203 | 14 | 8 |
| β-strand | 208-220 | 13 | 8 |
| α-helix | 223-225 | 3 | |
| α-helix | 226-230 | 5 | |
| α-helix | 231-242 | 12 | |
| α-helix | 251-273 | 23 | |
| α-helix | 284-310 | 27 | |
| α-helix | 314-412 | 30 | |
Chain E: 13 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-20 | 12 | |
| α-helix | 35 | 1 | |
| β-strand | 36-51 | 16 | 13 |
| β-strand | 56-68 | 13 | 13 |
| α-helix | 70-72 | 3 | |
| β-strand | 81-83 | 3 | 13 |
| α-helix | 85-90 | 6 | |
| β-strand | 96-98 | 3 | 14 |
| β-strand | 101-106 | 6 | 13 |
| β-strand | 110 | 1 | 3 |
| β-strand | 114-118 | 5 | 13 |
| β-strand | 123-135 | 13 | 13 |
| β-strand | 149-156 | 8 | 14 |
| β-strand | 164-168 | 5 | 13 |
| α-helix | 171-173 | 3 | |
| β-strand | 175-176 | 2 | 13 |
| β-strand | 186-200 | 15 | 14 |
| β-strand | 203-216 | 14 | 14 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-236 | 10 | |
| α-helix | 238-241 | 4 | |
| α-helix | 247-269 | 23 | |
| α-helix | 278-279 | 2 | |
| α-helix | 280-306 | 27 | |
| α-helix | 420-445 | 26 | |
Chain F: 1 helix, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-8 | 6 | 15 |
| β-strand | 10-13 | 4 | 16 |
| β-strand | 17-25 | 9 | 15 |
| β-strand | 32 | 1 | 17 |
| β-strand | 34-39 | 6 | 16 |
| β-strand | 46-51 | 6 | 16 |
| β-strand | 57-59 | 3 | 16 |
| β-strand | 68-72 | 5 | 15 |
| β-strand | 77-83 | 7 | 15 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-97 | 7 | 16 |
| β-strand | 99 | 1 | 17 |
| β-strand | 105 | 1 | 1 |
| β-strand | 117-118 | 2 | 16 |
| β-strand | 119 | 1 | 15 |
| β-strand | 122-127 | 6 | 16 |
Chain G: 2 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-8 | 6 | 18 |
| β-strand | 10-13 | 4 | 19 |
| β-strand | 17-25 | 9 | 18 |
| β-strand | 32-39 | 8 | 19 |
| β-strand | 46-51 | 6 | 19 |
| β-strand | 57-59 | 3 | 19 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 18 |
| β-strand | 77-83 | 7 | 18 |
| α-helix | 87-89 | 3 | |
| β-strand | 91-99 | 9 | 19 |
| β-strand | 105 | 1 | 9 |
| β-strand | 117-118 | 2 | 19 |
| β-strand | 122-127 | 6 | 19 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Gamma-aminobutyric acid receptor subunit alpha-2 | A, D | protein | 354 | Homo sapiens | P47869 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit beta-3,Soluble cytochrome b562 | B, E | protein | 451 | Homo sapiens | P0ABE7 (AlphaFold model), P28472 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit gamma-2 | C | protein | 371 | Homo sapiens | P18507 (AlphaFold model) |
| a2NB04 | F, G | protein | 138 | Lama glama | |
Sequence of entity 1 (A, D), FASTA
>9QJY_1 Gamma-aminobutyric acid receptor subunit alpha-2 (chains A, D)
NIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYT
IDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRI
QDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQV
APDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILS
QVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSAL
IEFATVNYFTKSQPARAAKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLGVSP
Sequence of entity 2 (B, E), FASTA
>9QJY_2 Gamma-aminobutyric acid receptor subunit beta-3,Soluble cytochrome b562 (chains B, E)
QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLT
MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER
IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA
FVNYIFFSQPAGTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPK
LEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLT
GRAAAIDRWSRIVFPFTFSLFNLVYWLYYVN
Sequence of entity 3 (C), FASTA
>9QJY_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
QKSDDDYEDYTSNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVN
SIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKAD
AHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIV
YQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQT
YIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV
SVCFIFVFSALVEYGTLHYFVSSQPARAAKMDSYARIFFPTAFCLFNLVYWVSYLYLGTG
TGTETSQVAPA
Sequence of entity 4 (F, G), FASTA
>9QJY_4 a2NB04 (chains F, G)
QVQLVESGGGLVQAGGSLRLSCAASGGTFSSYAVGWFRQAPGKEREFVATIWSGGSTYYT
DSVKGRFTISRDNAKNAVYLQMNSLKPEDTAVYYCAAQSVIRSIFTSDVKDASKYDYWGQ
GTQVTVSSHHHHHHEPEA
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ABU | Gamma-amino-butanoic acid | C4 H9 N O2 | 2 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 3 |
Primary citation
Determining the molecular and physiological actions of subtype-selective nanobodies of GABA A receptors. Gonzalez-Prada, J.E., Liu, S., Shang, C. et al. Sci Adv (2026) 12:eaeg3548-eaeg3548. DOI 10.1126/sciadv.aeg3548 · PubMed
Other PDB entries of the same protein (UniProt P47869 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9QJS 2.52 Å, GABA-A receptor a2b3 (1:4) + a2NB16(silent) + b3Mb125 + GABA
- 9QJX 2.7 Å, GABA-A receptor a2b3g2 + a2NB00(PAM) + GABA
- 9QJR 2.92 Å, GABA-A receptor a2b3 (1:4) + a2NB29(near-silent) + b3Mb125 + GABA
- 9QK0 3.01 Å, GABA-A receptor a2b3g2 + a2NB25(inhibitor)
- 9QK1 3.05 Å, GABA-A receptor a2b3 (1:4) + a2NB06(silent) + b3Mb125 + GABA
- 9CRV 3.18 Å, Native human GABAA receptor of beta2-alpha1-gamma2-beta2-alpha2 assembly
- 9CT0 3.19 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha2-gamma2 assembly
- 9CX7 3.3 Å, Native human GABAA receptor of beta3-alpha1-gamma2-beta3-alpha2 assembly
- 9CXC 3.3 Å, Native human GABAA receptor of beta3-alpha1-gamma2-beta2-alpha2 assembly
- 9CXB 3.33 Å, Native human GABAA receptor of beta2-alpha1-beta1-alpha2-gamma2 assembly
- 9CSB 3.34 Å, Native human GABAA receptor of beta3-alpha1-beta2-alpha2-gamma2 assembly
- 9CTV 3.36 Å, Native human GABAA receptor of beta2-alpha1-gamma2-beta1-alpha2 assembly
Browse structure collections
About this viewer
MolViewer shows 9QJY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.