9QK0: GABA-A receptor a2b3g2 + a2NB25(inhibitor)

GABA-A receptor a2b3g2 + a2NB25(inhibitor). Determined by electron microscopy at 3.01 Å resolution. Released 26 Aug 2026.

Method: Electron microscopy
Resolution: 3.01 Å
Organisms: Homo sapiens, Escherichia coli, Lama glama
Chains: 7
Atoms: 15,841
Mol. weight: 262.7 kDa
Ligands: NAG
Released: 26 Aug 2026

Explore 9QK0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QK0 contains 59 α-helices and 113 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	11-21	11
α-helix	22-24	3
β-strand	38-48	11	1
β-strand	52-53	2	2
β-strand	58-59	2	2
β-strand	61-68	8	1
β-strand	70	1	3
β-strand	82-85	4	1
α-helix	87-90	4
β-strand	98-100	3	4
β-strand	103	1	5
β-strand	107-108	2	1
β-strand	116-121	6	1
β-strand	125	1	3
β-strand	126-134	9	1
β-strand	136	1	5
β-strand	137	1	2
β-strand	149-152	4	4
β-strand	155-158	4	4
β-strand	166-170	5	1
β-strand	178-180	3	1
β-strand	190-203	14	4
β-strand	208-220	13	4
α-helix	223-226	4
α-helix	230-241	12
α-helix	243-245	3
α-helix	251-273	23
α-helix	284-308	25
α-helix	314-393	11
α-helix	396-411	16

Chain B: 12 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
α-helix	35	1
β-strand	36-41	6	6
β-strand	42-43	2	7
β-strand	44-51	8	6
β-strand	56-68	13	6
α-helix	70-72	3
β-strand	81	1	8
α-helix	85-90	6
β-strand	96-98	3	9
β-strand	106	1	6
β-strand	114-116	3	6
β-strand	118	1	8
β-strand	123-135	13	6
β-strand	147-148	2	9
β-strand	151-156	6	9
β-strand	164-168	5	6
α-helix	171-173	3
β-strand	175-176	2	7
β-strand	186-194	9	9
β-strand	197-199	3	10
β-strand	204-206	3	10
β-strand	207-216	10	9
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-235	9
α-helix	238-241	4
α-helix	247-271	25
α-helix	280-306	27
α-helix	423-446	24

Chain C: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
β-strand	51-56	6	11
β-strand	59-66	8	11
β-strand	71-79	9	11
β-strand	82-83	2	11
β-strand	96-98	3	11
α-helix	100-104	5
β-strand	111-113	3	12
β-strand	116-121	6	11
β-strand	129-133	5	11
β-strand	138-150	13	11
β-strand	162-163	2	12
β-strand	166-171	6	12
β-strand	179-183	5	11
β-strand	201-214	14	12
β-strand	219-231	13	12
α-helix	234-236	3
α-helix	237-241	5
α-helix	242-251	10
α-helix	252-254	3
α-helix	262-286	25
α-helix	295-322	28
α-helix	411-432	22

Chain D: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	11-21	11
β-strand	38-53	16	13
β-strand	58-70	13	13
β-strand	82-83	2	13
α-helix	87-91	5
β-strand	98-99	2	14
β-strand	103	1	15
β-strand	107-108	2	13
β-strand	116-121	6	13
β-strand	125-134	10	13
β-strand	136	1	15
β-strand	137	1	13
β-strand	149-156	8	16
β-strand	157-158	2	14
β-strand	166-170	5	13
α-helix	174-177	4
β-strand	178-180	3	13
β-strand	185	1	13
β-strand	190	1	17
β-strand	195-203	9	16
β-strand	208-219	12	16
β-strand	220	1	17
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-240	10
α-helix	243-245	3
α-helix	251-273	23
α-helix	284-307	24
α-helix	314-412	30

Chain E: 14 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
β-strand	36-51	16	18
β-strand	56-68	13	18
α-helix	70-72	3
β-strand	81-83	3	18
α-helix	85-90	6
β-strand	96-98	3	19
β-strand	101-106	6	18
β-strand	114-118	5	18
β-strand	123-135	13	18
β-strand	147-148	2	19
β-strand	153-156	4	19
β-strand	164-168	5	18
α-helix	171-173	3
β-strand	175-176	2	18
α-helix	178-180	3
β-strand	186-194	9	19
β-strand	199-200	2	20
β-strand	203-204	2	20
β-strand	207-216	10	19
α-helix	219-221	3
α-helix	222-226	5
α-helix	228-235	8
α-helix	238-241	4
α-helix	247-271	25
α-helix	273-274	2
α-helix	280-306	27
α-helix	420-427	8
α-helix	430-446	17

Chain F: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	21
β-strand	10-13	4	22
β-strand	18-24	7	21
β-strand	33-34	2	23
β-strand	35-39	5	22
β-strand	46-51	6	22
β-strand	58-60	3	22
α-helix	62-64	3
β-strand	68-73	6	21
β-strand	78-83	6	21
α-helix	88-90	3
β-strand	92-95	4	22
β-strand	97-99	3	23
β-strand	115-116	2	23
β-strand	120-125	6	22

Chain G: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	24
β-strand	10-13	4	25
β-strand	17-19	3	24
β-strand	21-24	4	24
β-strand	33-34	2	26
β-strand	35-39	5	25
β-strand	46-51	6	25
β-strand	58-60	3	25
α-helix	62-64	3
β-strand	68-73	6	24
β-strand	78-84	7	24
α-helix	88-90	3
β-strand	92-95	4	25
β-strand	98-99	2	26
β-strand	115	1	26
β-strand	120-125	6	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit alpha-2	A, D	protein	354	Homo sapiens	P47869 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-3,Soluble cytochrome b562	B, E	protein	451	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), P28472 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	C	protein	371	Homo sapiens	P18507 (AlphaFold model)
a2VHH25	F, G	protein	136	Lama glama

Sequence of entity 1 (A, D), FASTA

>9QK0_1 Gamma-aminobutyric acid receptor subunit alpha-2 (chains A, D)
NIQEDEAKNNITIFTRILDRLLDGYDNRLRPGLGDSITEVFTNIYVTSFGPVSDTDMEYT
IDVFFRQKWKDERLKFKGPMNILRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRI
QDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQV
APDGSRLNQYDLLGQSIGKETIKSSTGEYTVMTAHFHLKRKIGYFVIQTYLPCIMTVILS
QVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSAL
IEFATVNYFTKSQPARAAKIDRMSRIVFPVLFGTFNLVYWATYLNREPVLGVSP

Sequence of entity 2 (B, E), FASTA

>9QK0_2 Gamma-aminobutyric acid receptor subunit beta-3,Soluble cytochrome b562 (chains B, E)
QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLT
MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER
IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA
FVNYIFFSQPAGTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPK
LEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLT
GRAAAIDRWSRIVFPFTFSLFNLVYWLYYVN

Sequence of entity 3 (C), FASTA

>9QK0_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
QKSDDDYEDYTSNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVN
SIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKAD
AHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIV
YQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQT
YIPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFV
SVCFIFVFSALVEYGTLHYFVSSQPARAAKMDSYARIFFPTAFCLFNLVYWVSYLYLGTG
TGTETSQVAPA

Sequence of entity 4 (F, G), FASTA

>9QK0_4 a2VHH25 (chains F, G)
QVQLVESGGGLVRAGGSLRLSCAASRFTFDNYAIGWFRQAPGKAREGVSCISSTDGSTYY
ANSVKGRFTISSDNAKNTVYLQMNSLKPEDTAVYYCAATRKFYGPPFCDVDEYPYWGQGT
QVTVSSHHHHHHEPEA

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Determining the molecular and physiological actions of subtype-selective nanobodies of GABA A receptors. Gonzalez-Prada, J.E., Liu, S., Shang, C. et al. Sci Adv (2026) 12:eaeg3548-eaeg3548. DOI 10.1126/sciadv.aeg3548 · PubMed

Other PDB entries of the same protein (UniProt P47869 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QJS 2.52 Å, GABA-A receptor a2b3 (1:4) + a2NB16(silent) + b3Mb125 + GABA
9QJX 2.7 Å, GABA-A receptor a2b3g2 + a2NB00(PAM) + GABA
9QJY 2.78 Å, GABA-A receptor a2b3g2 + a2NB04(silent) + GABA
9QJR 2.92 Å, GABA-A receptor a2b3 (1:4) + a2NB29(near-silent) + b3Mb125 + GABA
9QK1 3.05 Å, GABA-A receptor a2b3 (1:4) + a2NB06(silent) + b3Mb125 + GABA
9CRV 3.18 Å, Native human GABAA receptor of beta2-alpha1-gamma2-beta2-alpha2 assembly
9CT0 3.19 Å, Native human GABAA receptor of beta2-alpha1-beta2-alpha2-gamma2 assembly
9CX7 3.3 Å, Native human GABAA receptor of beta3-alpha1-gamma2-beta3-alpha2 assembly
9CXC 3.3 Å, Native human GABAA receptor of beta3-alpha1-gamma2-beta2-alpha2 assembly
9CXB 3.33 Å, Native human GABAA receptor of beta2-alpha1-beta1-alpha2-gamma2 assembly
9CSB 3.34 Å, Native human GABAA receptor of beta3-alpha1-beta2-alpha2-gamma2 assembly
9CTV 3.36 Å, Native human GABAA receptor of beta2-alpha1-gamma2-beta1-alpha2 assembly

Browse structure collections

About this viewer

MolViewer shows 9QK0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.