9QQU: Engineered TPR domain

Crystal structure of an engineered TPR domain in complex with the HSP90 peptide MEEVD. Determined by X-ray diffraction at 2.13 Å resolution. Released 15 Apr 2026.

Method: X-ray diffraction
Resolution: 2.13 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,250
Mol. weight: 18.72 kDa
Released: 15 Apr 2026

Explore 9QQU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QQU contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	13-18	6
α-helix	21-38	18
α-helix	42-55	14
α-helix	60-73	14
α-helix	76-92	17
α-helix	97-113	17
α-helix	117-130	14
α-helix	134-147	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stress-induced-phosphoprotein 1	A	protein	151	Homo sapiens	P31948 (AlphaFold model)
Heat shock protein HSP 90-alpha	B	protein	6	Homo sapiens	P07900 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9QQU_1 Stress-induced-phosphoprotein 1 (chains A)
MHHHHHHSSGTENLYFQSLPENKKQAEREKELGNDAYKKKDFDTALEHYDKAIELDPTNM
TYITNQAAVYFEMGDYDKCRELCEKAIEVGRENRADYKQIAKAYARIANSYFKEGKYKDA
IKYYNKSLTEHRTPDVLKKCKEAEKILKEQE

Sequence of entity 2 (B), FASTA

>9QQU_2 Heat shock protein HSP 90-alpha (chains B)
XMEEVD

Primary citation

Engineering a robust protein-protein interaction motif. Bell, R., Pinotsis, N., Driva, D. et al. To be published.

Other PDB entries of the same protein (UniProt P31948 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ELW 1.6 Å, Crystal structure of the TPR1 domain of HOP in complex with a HSC70 peptide
1ELR 1.9 Å, Crystal structure of the TPR2A domain of HOP in complex with the HSP90 peptide MEEVD
3ESK 2.05 Å, Structure of HOP TPR2A domain in complex with the non-cognate Hsc70 peptide ligand
3FWV 2.2 Å, Crystal Structure of a Redesigned TPR Protein, T-MOD(VMY), in Complex with MEEVF Peptide
7KW7 3.57 Å, Atomic cryoEM structure of Hsp90-Hsp70-Hop-GR
2LNI Solution NMR Structure of Stress-induced-phosphoprotein 1 STI1 from Homo sapiens,…
2NC9 Apo solution structure of Hop TPR2A

Browse structure collections

About this viewer

MolViewer shows 9QQU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.