9YEI: Acetylcholine receptor subunit alpha
Human muscle nAChR SCCMS eL269F ACh, Reboxetine bound (lower 1). Determined by electron microscopy at 2.36 Å resolution. Released 5 Aug 2026.
- Method
- Electron microscopy
- Resolution
- 2.36 Å
- Organism
- Homo sapiens
- Chains
- 5
- Atoms
- 16,645
- Mol. weight
- 268.64 kDa
- Ligands
- ACH, NAG, A1D9Y
- Released
- 5 Aug 2026
Explore 9YEI in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9YEI contains 83 α-helices and 81 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 17 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| β-strand | 29-44 | 16 | 1 |
| β-strand | 49-61 | 13 | 1 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-80 | 4 | 1 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 2 |
| β-strand | 95 | 1 | 1 |
| β-strand | 108-111 | 4 | 1 |
| β-strand | 115-118 | 4 | 1 |
| β-strand | 121-127 | 7 | 1 |
| β-strand | 139-148 | 10 | 2 |
| β-strand | 156-160 | 5 | 1 |
| β-strand | 166 | 1 | 1 |
| α-helix | 170-173 | 4 | |
| β-strand | 176-190 | 15 | 2 |
| β-strand | 193-209 | 17 | 2 |
| α-helix | 212-214 | 3 | |
| α-helix | 215-219 | 5 | |
| α-helix | 220-230 | 11 | |
| α-helix | 231-233 | 3 | |
| α-helix | 242-260 | 19 | |
| α-helix | 261-263 | 3 | |
| α-helix | 273-299 | 27 | |
| α-helix | 310-313 | 4 | |
| α-helix | 314-319 | 6 | |
| α-helix | 320-323 | 4 | |
| α-helix | 371-422 | 52 | |
| α-helix | 423-427 | 5 | |
| α-helix | 428-436 | 9 | |
Chain B: 16 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-12 | 10 | |
| β-strand | 29-44 | 16 | 12 |
| β-strand | 49-61 | 13 | 12 |
| α-helix | 63-65 | 3 | |
| α-helix | 69-71 | 3 | |
| β-strand | 79-80 | 2 | 12 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 13 |
| β-strand | 95 | 1 | 12 |
| α-helix | 106-107 | 2 | |
| β-strand | 108-110 | 3 | 12 |
| β-strand | 115-118 | 4 | 12 |
| β-strand | 121-127 | 7 | 12 |
| β-strand | 139-148 | 10 | 13 |
| β-strand | 156-160 | 5 | 12 |
| β-strand | 162 | 1 | 14 |
| β-strand | 168 | 1 | 14 |
| β-strand | 171 | 1 | 15 |
| β-strand | 173-174 | 2 | 12 |
| α-helix | 176-178 | 3 | |
| β-strand | 180 | 1 | 12 |
| β-strand | 185-189 | 5 | 13 |
| β-strand | 191 | 1 | 15 |
| β-strand | 192-197 | 6 | 13 |
| β-strand | 207-218 | 12 | 13 |
| α-helix | 221-223 | 3 | |
| α-helix | 224-228 | 5 | |
| α-helix | 229-236 | 8 | |
| α-helix | 237-242 | 6 | |
| α-helix | 252-271 | 20 | |
| α-helix | 283-309 | 27 | |
| α-helix | 320-324 | 5 | |
| α-helix | 325-329 | 5 | |
| α-helix | 330-333 | 4 | |
| α-helix | 400-459 | 60 | |
Chain C: 15 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| α-helix | 28 | 1 | |
| β-strand | 29-44 | 16 | 3 |
| β-strand | 49-61 | 13 | 3 |
| α-helix | 69-72 | 4 | |
| β-strand | 77-81 | 5 | 3 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-92 | 3 | 4 |
| β-strand | 95 | 1 | 3 |
| β-strand | 107-111 | 5 | 3 |
| β-strand | 115-118 | 4 | 3 |
| β-strand | 121-127 | 7 | 3 |
| β-strand | 139-148 | 10 | 4 |
| β-strand | 156-160 | 5 | 3 |
| β-strand | 166 | 1 | 3 |
| α-helix | 170-173 | 4 | |
| β-strand | 176-190 | 15 | 4 |
| β-strand | 193-209 | 17 | 4 |
| α-helix | 212-214 | 3 | |
| α-helix | 215-219 | 5 | |
| α-helix | 220-228 | 9 | |
| α-helix | 231-233 | 3 | |
| α-helix | 242-263 | 22 | |
| α-helix | 273-299 | 27 | |
| α-helix | 310-313 | 4 | |
| α-helix | 314-319 | 6 | |
| α-helix | 320-322 | 3 | |
| α-helix | 370-435 | 66 | |
Chain D: 18 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-9 | 7 | |
| α-helix | 10-14 | 5 | |
| β-strand | 31-46 | 16 | 8 |
| β-strand | 51-63 | 13 | 8 |
| α-helix | 65-67 | 3 | |
| α-helix | 71-74 | 4 | |
| β-strand | 79-82 | 4 | 8 |
| α-helix | 84-86 | 3 | |
| β-strand | 92-94 | 3 | 9 |
| β-strand | 97 | 1 | 8 |
| α-helix | 108-109 | 2 | |
| β-strand | 110-113 | 4 | 8 |
| β-strand | 117-120 | 4 | 8 |
| β-strand | 123-129 | 7 | 8 |
| β-strand | 141-150 | 10 | 9 |
| β-strand | 158-162 | 5 | 8 |
| β-strand | 164-166 | 3 | 10 |
| β-strand | 171-173 | 3 | 10 |
| β-strand | 176 | 1 | 11 |
| β-strand | 178 | 1 | 8 |
| β-strand | 185 | 1 | 8 |
| β-strand | 190-194 | 5 | 9 |
| β-strand | 196 | 1 | 11 |
| β-strand | 197-201 | 5 | 9 |
| α-helix | 210-212 | 3 | |
| β-strand | 213-223 | 11 | 9 |
| α-helix | 226-228 | 3 | |
| α-helix | 229-233 | 5 | |
| α-helix | 234-242 | 9 | |
| α-helix | 243-248 | 6 | |
| α-helix | 251-253 | 3 | |
| α-helix | 256-277 | 22 | |
| α-helix | 287-313 | 27 | |
| α-helix | 324-328 | 5 | |
| α-helix | 329-333 | 5 | |
| α-helix | 334-338 | 5 | |
| α-helix | 415-472 | 58 | |
Chain E: 17 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-11 | 10 | |
| α-helix | 20-21 | 2 | |
| β-strand | 29-44 | 16 | 5 |
| β-strand | 49-61 | 13 | 5 |
| α-helix | 63-65 | 3 | |
| α-helix | 69-72 | 4 | |
| β-strand | 77-81 | 5 | 5 |
| β-strand | 90-92 | 3 | 6 |
| β-strand | 95 | 1 | 5 |
| β-strand | 107-111 | 5 | 5 |
| β-strand | 115-118 | 4 | 5 |
| β-strand | 121-127 | 7 | 5 |
| α-helix | 132-134 | 3 | |
| β-strand | 139-148 | 10 | 6 |
| β-strand | 156-160 | 5 | 5 |
| β-strand | 171 | 1 | 7 |
| β-strand | 173 | 1 | 5 |
| β-strand | 180 | 1 | 5 |
| β-strand | 185-189 | 5 | 6 |
| β-strand | 191 | 1 | 7 |
| β-strand | 192-195 | 4 | 6 |
| β-strand | 211-220 | 10 | 6 |
| α-helix | 223-225 | 3 | |
| α-helix | 226-230 | 5 | |
| α-helix | 231-242 | 12 | |
| α-helix | 243-245 | 3 | |
| α-helix | 248-250 | 3 | |
| α-helix | 253-272 | 20 | |
| α-helix | 284-310 | 27 | |
| α-helix | 318-320 | 3 | |
| α-helix | 321-324 | 4 | |
| α-helix | 325-330 | 6 | |
| α-helix | 331-335 | 5 | |
| α-helix | 408-468 | 61 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Acetylcholine receptor subunit alpha | A, C | protein | 437 | Homo sapiens | P02708 (AlphaFold model) |
| Acetylcholine receptor subunit beta | E | protein | 480 | Homo sapiens | P11230 (AlphaFold model) |
| Acetylcholine receptor subunit delta | D | protein | 496 | Homo sapiens | Q07001 (AlphaFold model) |
| Acetylcholine receptor subunit epsilon | B | protein | 473 | Homo sapiens | Q04844 (AlphaFold model) |
Sequence of entity 1 (A, C), FASTA
>9YEI_1 Acetylcholine receptor subunit alpha (chains A, C)
SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQQW
VDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTP
PAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKE
SRGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSG
EKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHH
RSPSTHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPM
GFHSPLIKHPEVKSAIEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCII
GTLAVFAGRLIELNQQG
Sequence of entity 2 (E), FASTA
>9YEI_2 Acetylcholine receptor subunit beta (chains E)
SEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLILAQLISLNEKDEEMSTKVYLDLEW
TDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNNDGNFDVALDISVVVSSDGSVRWQP
PGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVSLQTGLGPDGQGHQEIHIHEGTFI
ENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLIIRRKPLFYLVNVIAPCILITLLA
IFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPETSLSVPIIIKYLMFTMVLVTFSV
ILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRLKRPKPERDLMPEPPHCSSPGSGW
GRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFIDGPNRAVALLPELREVVSSISYI
ARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTSVGTLVIFLDATYHLPPPDPFPSR
Sequence of entity 3 (D), FASTA
>9YEI_3 Acetylcholine receptor subunit delta (chains D)
LNEEERLIRHLFQEKGYNKELRPVAHKEESVDVALALTLSNLISLKEVEETLTTNVWIEH
GWTDNRLKWNAEEFGNISVLRLPPDMVWLPEIVLENNNDGSFQISYSCNVLVYHYGFVYW
LPPAIFRSSCPISVTYFPFDWQNCSLKFSSLKYTAKEITLSLKQDAKENRTYPVEWIIID
PEGFTENGEWEIVHRPARVNVDPRAPLDSPSRQDITFYLIIRRKPLFYIINILVPCVLIS
FMVNLVFYLPADSGEKTSVAISVLLAQSVFLLLISKRLPATSMAIPLIGKFLLFGMVLVT
MVVVICVIVLNIHFRTPSTHVLSEGVKKLFLETLPELLHMSRPAEDGPSPGALVRRSSSL
GYISKAEEYFLLKSRSDLMFEKQSERHGLARRLTTARRPPASSEQAQQELFNELKPAVDG
ANFIVNHMRDQNNYNEEKDSWNRVARTVDRLCLFVVTPVMVVGTAWIFLQGVYNQPPPQP
FPGDPYSYNVQDKRFI
Sequence of entity 4 (B), FASTA
>9YEI_4 Acetylcholine receptor subunit epsilon (chains B)
KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDW
QDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLP
PAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYT
ENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRKPLFYVINIIVPCVLISGLVLL
AYFLPAQAGGQKCTVSINVLLAQTVFLFFIAQKIPETSLSVPLLGRFLIFVMVVATLIVM
NCVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLGSPPPPEAPRAASPPRRASSVGLLLR
AEELILKKPRSELVFEGQRHRQGTWTAAFCQSLGAAAPEVRCCVDAVNFVAESTRDQEAT
GEEVSDWVRMGNALDNICFWAALVLFSVGSSLIFLGAYFNRVPDLPYAPCIQP
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ACH | Acetylcholine | C7 H16 N O2 | 2 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
| A1D9Y | (2~{S})-2-[(~{S})-(2-ethoxyphenoxy)-phenyl-methyl]morpholine | C19 H23 N O3 | 1 |
Primary citation
Correcting congenital myasthenia-associated acetylcholine receptor defects. Li, H., Mukhtasimova, N., Teng, J. et al. Nature (2026) 656:516-524. DOI 10.1038/s41586-026-10706-1 · PubMed
Other PDB entries of the same protein (UniProt P02708 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9DMS 1.92 Å, Human muscle nAChR with fab6-bound
- 9DMG 2.05 Å, Human muscle nAChR apo state
- 9DMH 2.06 Å, Human muscle nAChR ACh-bound state
- 9DMQ 2.06 Å, Human muscle nAChR with fab3-bound
- 9DMV 2.13 Å, Human muscle nAChR with fab9-bound
- 9DMT 2.18 Å, Human muscle nAChR with fab7-bound
- 9DMJ 2.19 Å, Human muscle nAChR with two fab1b-bound
- 9YER 2.19 Å, Human muscle nAChR SCCMS eT264P ACh bound
- 9YE8 2.22 Å, Human muscle nAChR SCCMS eL269F ACh bound
- 4ZJS 2.23 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia Californica…
- 9DML 2.24 Å, Human muscle nAChR with fab2-bound
- 9YET 2.36 Å, Human muscle nAChR SCCMS eT264P ACh, Reboxetine bound
Browse structure collections
About this viewer
MolViewer shows 9YEI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.