9ZZO: MP1104-bound Kappa Opioid Receptor

MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1. Determined by electron microscopy at 2.6 Å resolution. Released 17 Jun 2026.

Method: Electron microscopy
Resolution: 2.6 Å
Organisms: Lama glama, Homo sapiens, synthetic construct
Chains: 5
Atoms: 8,637
Mol. weight: 146.24 kDa
Ligands: PIO, CVV
Released: 17 Jun 2026

Explore 9ZZO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ZZO contains 24 α-helices and 86 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	58-87	30
α-helix	93-121	29
α-helix	128-160	33
α-helix	163-169	7
α-helix	172-195	24
α-helix	223-236	14
α-helix	238-254	17
α-helix	266-298	33
α-helix	307-332	26
β-strand	382-385	4	5

Chain C: 8 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	1	1	4
β-strand	4	1	4
β-strand	7-12	6	5
β-strand	18-22	5	5
β-strand	26-28	3	6
β-strand	29	1	7
β-strand	34	1	7
α-helix	35-36	2
β-strand	37-43	7	5
β-strand	52-62	11	8
β-strand	76-87	12	8
α-helix	89-90	2
α-helix	95-98	4
α-helix	99-108	10
β-strand	112-117	6	5
β-strand	128-129	2	8
α-helix	130-132	3
β-strand	140-151	12	8
β-strand	163-168	6	8
β-strand	169-171	3	6
α-helix	180-182	3
β-strand	183-188	6	9
β-strand	197-203	7	9
β-strand	207-208	2	10
β-strand	214-222	9	9
β-strand	228-242	15	11
β-strand	246-258	13	11
β-strand	262	1	11
β-strand	266-274	9	9
β-strand	288-289	2	8
β-strand	300	1	8
α-helix	301-305	5
β-strand	316-329	14	11
β-strand	334-341	8	11
β-strand	342-343	2	10
α-helix	345-347	3

Chain E: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	19-25	7	1
β-strand	34-39	6	3
β-strand	45-51	7	3
β-strand	57-59	3	3
β-strand	77-81	5	1
α-helix	87-89	3
β-strand	92-97	6	3
β-strand	108-109	2	3
β-strand	110-112	3	2

Chain H: 2 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	12
β-strand	14-15	2	13
β-strand	20-28	9	12
β-strand	35-42	8	14
β-strand	44	1	15
β-strand	46	1	15
β-strand	48-55	8	14
β-strand	60-63	4	14
β-strand	71-76	6	12
β-strand	81-87	7	12
α-helix	91-93	3
β-strand	95-103	9	14
β-strand	110-113	4	14
β-strand	117-119	3	14
β-strand	120-121	2	13
β-strand	130-134	5	16
β-strand	146-155	10	16
β-strand	160-164	5	17
β-strand	169	1	17
β-strand	173-175	3	16
α-helix	176-178	3
β-strand	179-180	2	16
β-strand	186-194	9	16
β-strand	205	1	18
β-strand	206-210	5	17
β-strand	216-217	2	17
β-strand	220	1	18

Chain L: 4 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	19
β-strand	11-14	4	20
β-strand	20-26	7	19
β-strand	34-39	6	20
β-strand	41	1	21
β-strand	43	1	21
β-strand	45-50	6	20
β-strand	54-55	2	20
α-helix	56	1
β-strand	63-68	6	19
β-strand	71-76	6	19
α-helix	81-83	3
β-strand	86-91	6	20
β-strand	98-99	2	20
β-strand	103-107	5	20
β-strand	112	1	22
β-strand	115-119	5	23
α-helix	123-126	4
β-strand	132-140	9	23
β-strand	141	1	22
β-strand	146-148	3	24
β-strand	160-164	5	23
β-strand	174-181	8	23
α-helix	184-189	6
β-strand	192-198	7	24
β-strand	207-211	5	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nanobody 32	E	protein	124	Lama glama
Isoform 1B of Beta-arrestin-1	C	protein	387	Homo sapiens	P49407 (AlphaFold model)
Kappa-type opioid receptor,Vasopressin V2 receptor	A	protein	341	Homo sapiens	P30518 (AlphaFold model), P41145 (AlphaFold model)
Fab30 heavy chain	H	protein	241	synthetic construct
Fab30 light chain	L	protein	215	synthetic construct

Sequence of entity 1 (E), FASTA

>9ZZO_1 Nanobody 32 (chains E)
QVQLQESGGGLVQAGGSLRLSCVVSGFFFDTVTMAWYRRAPGKHRELVASATAGGTTTYA
DSVKDRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTFVRSLSWGQGTQVTVSSHHHHHH
EPEA

Sequence of entity 2 (C), FASTA

>9ZZO_2 Isoform 1B of Beta-arrestin-1 (chains C)
GSAGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLT
AAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFE
IPPNLPSSVTLQPGPEDTGKAIGVDYEVKAFVAENLEEKIHKRNSVRLVIEKVQYAPERP
GPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQY
ADIVLFNTAQYKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDT
NLASSTLLREGANREILGIIVSYKVKVKLVVSRGGDVAVELPFTLMHPKPKEEPPHREVP
ENETPVDTNLIELDTNDDDAAAEDFAR

Sequence of entity 3 (A), FASTA

>9ZZO_3 Kappa-type opioid receptor,Vasopressin V2 receptor (chains A)
ISPAIPVIITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMP
FQSTVYLMNSWPFGDVLCKIVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPL
KAKIINICIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIF
AFVIPVLIIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIF
ILVEALGSTSHSTAALSSYYFCIALGYTNSCLNPILYAFLDENFKRCFRDFCFPLKMRME
RQSTSRVRNTARGRTPPSLGPQDESCTTASSSLAKDTSSGG

Sequence of entity 4 (H), FASTA

>9ZZO_4 Fab30 heavy chain (chains H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYGY
TYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLVT
VSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTGSHHHHHHHHG
G

Sequence of entity 5 (L), FASTA

>9ZZO_5 Fab30 light chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Ligands and cofactors

ID	Name	Formula	Copies
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	1
CVV	N-[(5alpha,6beta)-17-(cyclopropylmethyl)-3-hydroxy-7,8-didehydro-4,5-epoxymorph…	C27 H27 I N2 O3	1

Primary citation

Structural dynamics of kappa opioid receptor interactions with beta-arrestin 1. Han, J., Fine, E.J., Jiang, Q. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-73968-3 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
25GN 3.2 Å, receptor-arrestin
8AS2 3.2 Å, Structure of arrestin2 in complex with 4P CCR5 phosphopeptide and Fab30

Browse structure collections

About this viewer

MolViewer shows 9ZZO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.