8R07: C-terminal Rel-homology Domain of NFAT1

C-terminal Rel-homology Domain of NFAT1. Determined by X-ray diffraction at 1.74 Å resolution. Released 6 Mar 2024.

Method: X-ray diffraction
Resolution: 1.74 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,993
Mol. weight: 24.55 kDa
Released: 6 Mar 2024

Explore 8R07 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8R07 contains 7 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	579-583	5	1
β-strand	587-589	3	2
β-strand	595-601	7	1
β-strand	608-614	7	2
β-strand	620-626	7	2
α-helix	627	1
β-strand	628	1	1
β-strand	634	1	1
β-strand	637-641	5	1
α-helix	642-645	4
β-strand	654-661	8	2
β-strand	667	1	2
α-helix	668-670	3
β-strand	671-676	6	2

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	577-578	2
β-strand	579-583	5	3
β-strand	587-589	3	4
β-strand	595-601	7	3
β-strand	608-614	7	4
β-strand	620-626	7	4
α-helix	627	1
β-strand	628	1	3
β-strand	634	1	3
β-strand	637-641	5	3
α-helix	642-645	4
β-strand	654-662	9	4
β-strand	666-667	2	4
α-helix	668-670	3
β-strand	671-676	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear factor of activated T-cells, cytoplasmic 2	A, B	protein	105	Homo sapiens	Q13469 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8R07_1 Nuclear factor of activated T-cells, cytoplasmic 2 (chains A, B)
GHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKS
QPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV

Primary citation

Ligandability assessment of the C-terminal Rel-homology domain of NFAT1. Bottcher, J., Fuchs, J.E., Mayer, M. et al. Arch Pharm (Weinheim) (2024) 357:e2300649-e2300649. DOI 10.1002/ardp.202300649 · PubMed

Other PDB entries of the same protein (UniProt Q13469 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8R3F 1.55 Å, C-terminal Rel-homology Domain of NFAT1
1P7H 2.6 Å, Structure of NFAT1 bound as a dimer to the HIV-1 LTR kB element
9VRT 2.64 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2-P DNA
9VS2 2.65 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE3-P DNA
1A02 2.7 Å, Structure of the DNA binding domains of nfat, fos and jun bound to DNA
2AS5 2.7 Å, Structure of the DNA binding domains of NFAT and FOXP2 bound specifically to DNA.
8OW4 2.75 Å, 2.75 angstrom crystal structure of human NFAT1 with bound DNA
3QRF 2.8 Å, Structure of a domain-swapped FOXP3 dimer
9VRQ 2.8 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2 DNA
1OWR 3.0 Å, Crystal structure of human NFAT1 bound monomerically to DNA
2O93 3.05 Å, Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element
1PZU 3.1 Å, An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site

Browse structure collections

About this viewer

MolViewer shows 8R07 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.