1OWR: Human NFAT1 bound monomerically to DNA

Crystal structure of human NFAT1 bound monomerically to DNA. Determined by X-ray diffraction at 3.0 Å resolution. Released 10 Feb 2004.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 12
Atoms: 11,436
Mol. weight: 165.96 kDa
Released: 10 Feb 2004

Explore 1OWR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OWR contains 30 α-helices and 106 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain M: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	402	1	1
β-strand	404-405	2	2
β-strand	408-414	7	2
β-strand	419	1	3
β-strand	423	1	4
β-strand	442-446	5	2
β-strand	454-461	8	1
α-helix	465-467	3
β-strand	470	1	1
β-strand	474-478	5	4
β-strand	489-493	5	1
β-strand	496-503	8	1
α-helix	505-507	3
β-strand	510-512	3	2
β-strand	516-520	5	4
α-helix	523-527	5
β-strand	541-542	2	3
β-strand	543-551	9	1
β-strand	557-563	7	1
β-strand	567-568	2	3
α-helix	571-572	2
β-strand	579-582	4	5
β-strand	587-589	3	6
β-strand	595-601	7	5
β-strand	608-613	6	6
β-strand	622-626	5	6
α-helix	627	1
β-strand	628-629	2	5
β-strand	637-641	5	5
α-helix	642-645	4
β-strand	654-661	8	6
β-strand	667	1	6
α-helix	669-670	2
β-strand	671-676	6	6

Chain N: 7 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	402	1	7
β-strand	404-405	2	8
β-strand	408-414	7	8
α-helix	415-417	3
β-strand	419	1	7
β-strand	423-424	2	9
β-strand	442-446	5	8
β-strand	454-462	9	7
β-strand	470	1	7
β-strand	474-478	5	9
β-strand	489-493	5	7
β-strand	496-503	8	7
α-helix	505-507	3
β-strand	510-512	3	8
β-strand	516-520	5	9
α-helix	523-528	6
β-strand	541-551	11	7
β-strand	557-563	7	7
β-strand	567-568	2	7
α-helix	572-575	4
β-strand	579-582	4	10
β-strand	587-589	3	11
β-strand	595-601	7	10
β-strand	608-613	6	11
β-strand	622-626	5	11
α-helix	627	1
β-strand	628	1	10
β-strand	637-641	5	10
α-helix	642-645	4
β-strand	654-661	8	11
β-strand	667	1	11
α-helix	669-670	2
β-strand	671-676	6	11

Chain P: 10 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	402	1	12
β-strand	404-405	2	13
β-strand	408-414	7	13
α-helix	415-417	3
β-strand	419	1	12
β-strand	423-424	2	14
α-helix	433-435	3
β-strand	442-446	5	13
β-strand	454-462	9	12
β-strand	470	1	12
β-strand	474-478	5	14
β-strand	489-493	5	12
β-strand	496-503	8	12
α-helix	505-507	3
β-strand	510-512	3	13
β-strand	516-520	5	14
α-helix	521-522	2
α-helix	523-527	5
β-strand	541-551	11	12
β-strand	557-563	7	12
α-helix	564-566	3
β-strand	567-568	2	12
α-helix	573-576	4
β-strand	579-582	4	15
β-strand	588-589	2	16
β-strand	595-601	7	15
β-strand	608-613	6	16
β-strand	622-626	5	16
α-helix	627	1
β-strand	628-629	2	15
β-strand	637-641	5	15
α-helix	642-645	4
β-strand	654-661	8	16
β-strand	667	1	16
α-helix	669-670	2
β-strand	671-676	6	16

Chain Q: 6 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	402	1	17
β-strand	404-405	2	18
β-strand	408-414	7	18
α-helix	415-417	3
β-strand	419	1	17
β-strand	423-424	2	19
β-strand	432	1	19
β-strand	442-446	5	18
β-strand	454-462	9	17
β-strand	470	1	17
β-strand	474-478	5	19
β-strand	489-493	5	17
β-strand	496-503	8	17
α-helix	505-507	3
β-strand	510-512	3	18
β-strand	516-520	5	19
α-helix	521-522	2
α-helix	523-527	5
β-strand	541-551	11	17
β-strand	557-563	7	17
β-strand	567-568	2	17
α-helix	571-575	5
β-strand	579-582	4	20
β-strand	587-589	3	21
β-strand	595-601	7	20
β-strand	608-613	6	21
β-strand	622-626	5	21
β-strand	628-629	2	20
β-strand	637-641	5	20
α-helix	642-645	4
β-strand	654-663	10	21
β-strand	666-667	2	21
β-strand	671-676	6	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NFAT1 Monomeric Binding Site, Plus Strand	A, C, E, G	DNA	15
NFAT1 Monomeric Binding Site, Minus Strand	B, D, F, H	DNA	15
Nuclear factor of activated T-cells, cytoplasmic 2	M, N, P, Q	protein	284	Homo sapiens	Q13469 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>1OWR_1 NFAT1 Monomeric Binding Site, Plus Strand (chains A, C, E, G)
TTGCTGGAAAAATAG

Sequence of entity 2 (B, D, F, H), FASTA

>1OWR_2 NFAT1 Monomeric Binding Site, Minus Strand (chains B, D, F, H)
AACTATTTTTCCAGC

Sequence of entity 3 (M, N, P, Q), FASTA

>1OWR_3 Nuclear factor of activated T-cells, cytoplasmic 2 (chains M, N, P, Q)
VPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPL
GLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATID
CAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSA
HELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQ
PNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPV

Primary citation

Structure of NFAT Bound to DNA as a Monomer. Stroud, J.C., Chen, L. J Mol Biol (2003) 334:1009-1022. DOI 10.1016/j.jmb.2003.09.065 · PubMed

Other PDB entries of the same protein (UniProt Q13469 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8R3F 1.55 Å, C-terminal Rel-homology Domain of NFAT1
8R07 1.74 Å, C-terminal Rel-homology Domain of NFAT1
1P7H 2.6 Å, Structure of NFAT1 bound as a dimer to the HIV-1 LTR kB element
9VRT 2.64 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2-P DNA
9VS2 2.65 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE3-P DNA
1A02 2.7 Å, Structure of the DNA binding domains of nfat, fos and jun bound to DNA
2AS5 2.7 Å, Structure of the DNA binding domains of NFAT and FOXP2 bound specifically to DNA.
8OW4 2.75 Å, 2.75 angstrom crystal structure of human NFAT1 with bound DNA
3QRF 2.8 Å, Structure of a domain-swapped FOXP3 dimer
9VRQ 2.8 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2 DNA
2O93 3.05 Å, Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element
1PZU 3.1 Å, An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site

Browse structure collections

About this viewer

MolViewer shows 1OWR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.