2O93: NFAT

Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element. Determined by X-ray diffraction at 3.05 Å resolution. Released 19 Jun 2007.

Method: X-ray diffraction
Resolution: 3.05 Å
Organism: Homo sapiens
Chains: 5
Atoms: 7,866
Mol. weight: 118.04 kDa
Released: 19 Jun 2007

Explore 2O93 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2O93 contains 15 α-helices and 79 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain L: 3 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	402	1	1
β-strand	404	1	2
β-strand	409-414	6	2
β-strand	419	1	1
β-strand	423	1	3
β-strand	442-446	5	2
β-strand	454-462	9	1
β-strand	470	1	1
β-strand	474-478	5	3
β-strand	489-493	5	1
β-strand	496-503	8	1
α-helix	505-507	3
β-strand	510-512	3	2
β-strand	516-520	5	3
α-helix	523-528	6
β-strand	541-551	11	1
β-strand	557-563	7	1
β-strand	567-568	2	1
β-strand	579-583	5	4
β-strand	587-589	3	5
β-strand	595-601	7	4
β-strand	607-614	8	5
β-strand	620-626	7	5
β-strand	627-628	2	4
β-strand	634	1	4
β-strand	637-641	5	4
α-helix	643-645	3
β-strand	654-662	9	5
β-strand	667	1	5
β-strand	671-676	6	5

Chain M: 4 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	404-405	2	6
β-strand	408-414	7	6
β-strand	419	1	7
β-strand	423-424	2	8
β-strand	432	1	8
β-strand	442-446	5	6
β-strand	454-461	8	9
β-strand	470	1	9
β-strand	474-478	5	8
β-strand	489-493	5	9
β-strand	496-503	8	9
α-helix	505-507	3
β-strand	510-511	2	6
β-strand	516-520	5	8
α-helix	523-527	5
β-strand	541-542	2	7
β-strand	543-551	9	9
β-strand	557-563	7	9
β-strand	567-568	2	7
α-helix	576-578	3
β-strand	579-583	5	10
β-strand	587-589	3	11
β-strand	595-601	7	10
β-strand	608-614	7	11
β-strand	620-626	7	11
β-strand	627-628	2	10
β-strand	637-641	5	10
α-helix	643-645	3
β-strand	654-661	8	11
β-strand	667	1	11
β-strand	671-676	6	11

Chain O: 8 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	409-414	6	12
α-helix	415-417	3
β-strand	419	1	13
β-strand	423	1	14
β-strand	442-446	5	12
α-helix	453	1
β-strand	454-462	9	13
β-strand	470	1	13
β-strand	474-478	5	14
β-strand	489-493	5	13
β-strand	496-503	8	13
α-helix	505-507	3
β-strand	512	1	12
β-strand	516-520	5	14
α-helix	521-522	2
α-helix	523-526	4
β-strand	541-551	11	13
β-strand	557-561	5	13
β-strand	567-568	2	13
α-helix	571-575	5
β-strand	579-583	5	15
β-strand	587-589	3	16
β-strand	595-601	7	15
β-strand	609-614	6	16
β-strand	620-626	7	16
β-strand	627-634	8	15
β-strand	637-641	5	15
α-helix	643-645	3
β-strand	654-660	7	16
β-strand	661	1	17
β-strand	667	1	17
β-strand	671-676	6	16
α-helix	677	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
kappaB enhancer element, DNA 25-mer	A	DNA	25
kappaB enhancer element, DNA 25-mer	B	DNA	25
actor of activated T-cells, cytoplasmic 2	L, M, O	protein	301	Homo sapiens	Q13469 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2O93_1 kappaB enhancer element, DNA 25-mer (chains A)
AGGGACTTTCCGCTGGGGACTTTCC

Sequence of entity 2 (B), FASTA

>2O93_2 kappaB enhancer element, DNA 25-mer (chains B)
TGGAAAGTCCCCAGCGGAAAGTCCC

Sequence of entity 3 (L, M, O), FASTA

>2O93_3 actor of activated T-cells, cytoplasmic 2 (chains L, M, O)
MRGSHHHHHHTAPHASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPT
GGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTK
VLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRI
VSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTD
GQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHP
V

Primary citation

Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element. Bates, D.L., Barthel, K.K., Wu, Y. et al. Structure (2008) 16:684-694. DOI 10.1016/j.str.2008.01.020 · PubMed

Other PDB entries of the same protein (UniProt Q13469 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8R3F 1.55 Å, C-terminal Rel-homology Domain of NFAT1
8R07 1.74 Å, C-terminal Rel-homology Domain of NFAT1
1P7H 2.6 Å, Structure of NFAT1 bound as a dimer to the HIV-1 LTR kB element
9VRT 2.64 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2-P DNA
9VS2 2.65 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE3-P DNA
1A02 2.7 Å, Structure of the DNA binding domains of nfat, fos and jun bound to DNA
2AS5 2.7 Å, Structure of the DNA binding domains of NFAT and FOXP2 bound specifically to DNA.
8OW4 2.75 Å, 2.75 angstrom crystal structure of human NFAT1 with bound DNA
3QRF 2.8 Å, Structure of a domain-swapped FOXP3 dimer
9VRQ 2.8 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2 DNA
1OWR 3.0 Å, Crystal structure of human NFAT1 bound monomerically to DNA
1PZU 3.1 Å, An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site

Browse structure collections

About this viewer

MolViewer shows 2O93 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.