1PZU: PDB entry 1PZU

An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site. Determined by X-ray diffraction at 3.1 Å resolution. Released 9 Sept 2003.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 12
Atoms: 14,952
Mol. weight: 231.3 kDa
Released: 9 Sept 2003

Explore 1PZU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PZU contains 38 α-helices and 148 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains B and H: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	404	1	1
β-strand	410-414	5	2
α-helix	415-417	3
β-strand	419	1	1
β-strand	423	1	3
β-strand	442-445	4	2
β-strand	454-462	9	1
β-strand	470	1	1
β-strand	474-478	5	3
β-strand	491-492	2	1
β-strand	498-503	6	1
α-helix	505-507	3
β-strand	510-512	3	2
β-strand	516-520	5	3
α-helix	523-527	5
β-strand	541-551	11	1
β-strand	557-563	7	1
β-strand	567-568	2	1
β-strand	579-583	5	4
β-strand	587-589	3	5
β-strand	595-601	7	4
β-strand	608-614	7	5
β-strand	620-626	7	5
α-helix	627	1
β-strand	634	1	4
β-strand	637-641	5	4
α-helix	643-645	3
β-strand	654-661	8	5
β-strand	667	1	5
α-helix	668-670	3
β-strand	671-676	6	5

Chain D: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	404	1	6
β-strand	410-414	5	7
α-helix	415-417	3
β-strand	419	1	6
β-strand	423	1	8
α-helix	432-435	4
β-strand	442-445	4	7
β-strand	454-462	9	6
β-strand	470	1	6
β-strand	474-478	5	8
β-strand	491	1	6
β-strand	499-503	5	6
α-helix	505-507	3
β-strand	510-512	3	7
β-strand	516-520	5	8
α-helix	523-527	5
β-strand	541-551	11	6
β-strand	557-563	7	6
β-strand	567-568	2	6
β-strand	579-583	5	9
β-strand	587-589	3	10
β-strand	595-601	7	9
β-strand	608-614	7	10
β-strand	620-626	7	10
α-helix	627	1
β-strand	634	1	9
β-strand	637-641	5	9
α-helix	643-645	3
β-strand	654-661	8	10
β-strand	667	1	10
α-helix	668-670	3
β-strand	671-676	6	10

Chain I: 6 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	404	1	16
β-strand	410-414	5	17
α-helix	415-417	3
β-strand	419	1	16
β-strand	423	1	18
β-strand	442-445	4	17
β-strand	454-462	9	16
β-strand	470	1	16
β-strand	474-478	5	18
β-strand	491	1	16
β-strand	499-503	5	16
α-helix	505-507	3
β-strand	510-512	3	17
β-strand	516-520	5	18
α-helix	523-527	5
β-strand	541-551	11	16
β-strand	557-563	7	16
β-strand	567-568	2	16
β-strand	579-583	5	19
β-strand	587-589	3	20
β-strand	595-601	7	19
β-strand	608-614	7	20
β-strand	620-626	7	20
α-helix	627	1
β-strand	634	1	19
β-strand	637-641	5	19
α-helix	643-645	3
β-strand	654-661	8	20
β-strand	667	1	20
α-helix	668-670	3
β-strand	671-676	6	20

Chain L: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	404	1	21
β-strand	410-414	5	22
α-helix	415-417	3
β-strand	419	1	21
β-strand	423	1	23
α-helix	432-435	4
β-strand	442-445	4	22
β-strand	454-462	9	21
β-strand	470	1	21
β-strand	474-478	5	23
β-strand	491-492	2	21
β-strand	498-503	6	21
α-helix	505-507	3
β-strand	510-512	3	22
β-strand	516-520	5	23
α-helix	523-527	5
β-strand	541-551	11	21
β-strand	557-568	12	21
β-strand	579-583	5	24
β-strand	587-589	3	25
β-strand	595-601	7	24
β-strand	608-614	7	25
β-strand	620-626	7	25
α-helix	627	1
β-strand	634	1	24
β-strand	637-641	5	24
α-helix	643-645	3
β-strand	654-661	8	25
β-strand	667	1	25
α-helix	668-670	3
β-strand	671-676	6	25

Chain M: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	404	1	26
β-strand	410-414	5	27
α-helix	415-417	3
β-strand	419	1	26
β-strand	423	1	28
β-strand	442-445	4	27
β-strand	454-461	8	26
β-strand	470	1	26
β-strand	474-478	5	28
β-strand	491	1	26
β-strand	499-503	5	26
α-helix	505-507	3
β-strand	510-512	3	27
β-strand	516-520	5	28
α-helix	523-527	5
β-strand	541-551	11	26
β-strand	557-568	12	26
β-strand	579-583	5	29
β-strand	587-589	3	30
β-strand	595-601	7	29
β-strand	608-614	7	30
β-strand	620-626	7	30
α-helix	627	1
β-strand	634	1	29
β-strand	637-641	5	29
α-helix	643-645	3
β-strand	654-661	8	30
β-strand	667	1	30
α-helix	668-670	3
β-strand	671-676	6	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(tptpgpapgpgpapaptptptpcpcpa)-3'	T, V, X	DNA	14
5'-d(apaptpgpgpapapaptptpcpcptpc)-3'	W, Y, Z	DNA	14
Nuclear factor of activated T-cells, cytoplasmic 2	B, D, H, I, L, M	protein	301	Homo sapiens	Q13469 (AlphaFold model)

Sequence of entity 1 (T, V, X), FASTA

>1PZU_1 5'-D(*TP*TP*GP*AP*GP*GP*AP*AP*TP*TP*TP*CP*CP*A)-3' (chains T, V, X)
TTGAGGAATTTCCA

Sequence of entity 2 (W, Y, Z), FASTA

>1PZU_2 5'-D(*AP*AP*TP*GP*GP*AP*AP*AP*TP*TP*CP*CP*TP*C)-3' (chains W, Y, Z)
AATGGAAATTCCTC

Sequence of entity 3 (B, D, H, I, L, M), FASTA

>1PZU_3 Nuclear factor of activated T-cells, cytoplasmic 2 (chains B, D, H, I, L, M)
MRGSHHHHHHTDPHASSVPLEWPLSSQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPT
GGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTK
VLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRI
VSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTD
GQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHP
V

Primary citation

An asymmetric NFAT1 dimer on a pseudo-palindromic KB-like DNA site. Jin, L., Sliz, P., Chen, L. et al. Nat Struct Biol (2003) 10:807-811. DOI 10.1038/nsb975 · PubMed

Other PDB entries of the same protein (UniProt Q13469 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8R3F 1.55 Å, C-terminal Rel-homology Domain of NFAT1
8R07 1.74 Å, C-terminal Rel-homology Domain of NFAT1
1P7H 2.6 Å, Structure of NFAT1 bound as a dimer to the HIV-1 LTR kB element
9VRT 2.64 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2-P DNA
9VS2 2.65 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE3-P DNA
1A02 2.7 Å, Structure of the DNA binding domains of nfat, fos and jun bound to DNA
2AS5 2.7 Å, Structure of the DNA binding domains of NFAT and FOXP2 bound specifically to DNA.
8OW4 2.75 Å, 2.75 angstrom crystal structure of human NFAT1 with bound DNA
3QRF 2.8 Å, Structure of a domain-swapped FOXP3 dimer
9VRQ 2.8 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2 DNA
1OWR 3.0 Å, Crystal structure of human NFAT1 bound monomerically to DNA
2O93 3.05 Å, Crystal structure of NFAT bound to the HIV-1 LTR tandem kappaB enhancer element

Browse structure collections

About this viewer

MolViewer shows 1PZU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.