1B53: Human mip-1A D26A, minimized average structure

Name: PDB 1B53: NMR structure of human mip-1A D26A, minimized average structure
Published: 1999-07-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chemokine

NMR structure of human mip-1A D26A, minimized average structure. Determined by solution NMR. Released 22 Jul 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,076
Mol. weight: 15.36 kDa
Released: 22 Jul 1999

Explore 1B53 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B53 contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	21-23	3
α-helix	58-63	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mip-1A	A, B	protein	69	Homo sapiens	P10147 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1B53_1 MIP-1A (chains A, B)
SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQK
YVSDLELSA

Primary citation

Identification of amino acid residues critical for aggregation of human CC chemokines macrophage inflammatory protein (MIP)-1alpha, MIP-1beta, and RANTES. Characterization of active disaggregated chemokine variants. Czaplewski, L.G., McKeating, J., Craven, C.J. et al. J Biol Chem (1999) 274:16077-16084. DOI 10.1074/jbc.274.23.16077 · PubMed

Other PDB entries of the same protein (UniProt P10147 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FPU 1.76 Å, The crystallographic structure of the Complex between Evasin-1 and CCL3
2X6G 2.18 Å, X-ray Structure of Macrophage Inflammatory Protein-1 alpha (D27A)
5COR 2.55 Å, X-ray structure of macrophage inflammatory protein-1 alpha (CCL3) N-terminal-switch…
4RA8 2.6 Å, Structure analysis of the Mip1a P8A mutant
7F1T 2.6 Å, Crystal structure of the human chemokine receptor CCR5 in complex with MIP-1a
2X69 2.65 Å, X-ray Structure of Macrophage Inflammatory Protein-1 alpha polymer
3KBX 2.65 Å, Human macrophage inflammatory protein-1 alpha L3M_V63M
4ZKB 2.9 Å, The chemokine binding protein of orf virus complexed with CCL3
7F1Q 2.9 Å, Cryo-EM structure of the chemokine receptor CCR5 in complex with MIP-1a and Gi
3H44 3.0 Å, Crystal Structure of Insulin Degrading Enzyme in Complex with macrophage inflammatory…
5D65 3.1 Å, X-ray structure of macrophage inflammatory protein-1 alpha (CCL3) with heparin complex
1B50 NMR structure of human mip-1A D26A, 10 structures

Browse structure collections

About this viewer

MolViewer shows 1B53 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.