2X69: Macrophage Inflammatory Protein-1 alpha polymer

X-ray Structure of Macrophage Inflammatory Protein-1 alpha polymer. Determined by X-ray diffraction at 2.65 Å resolution. Released 3 Nov 2010.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: HOMO SAPIENS
Chains: 5
Atoms: 2,618
Mol. weight: 38.97 kDa
Released: 3 Nov 2010

Explore 2X69 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2X69 contains 17 α-helices and 19 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	22-24	3
β-strand	25-30	6	1
α-helix	31-32	2
β-strand	40-44	5	1
β-strand	49-52	4	1
α-helix	57-67	11

Chain B: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-8	2
β-strand	9-11	3	2
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	3
α-helix	31-32	2
β-strand	40-44	5	3
β-strand	49-52	4	3
α-helix	57-67	11

Chain C: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	9-11	3	2
α-helix	22-24	3
β-strand	25-30	6	4
β-strand	40-44	5	4
β-strand	49-52	4	4
α-helix	57-68	12

Chain D: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-8	2
β-strand	9-11	3	5
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	6
β-strand	40-44	5	6
β-strand	49-52	4	6
α-helix	57-67	11

Chain E: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	9-11	3	5
α-helix	19-20	2
β-strand	25-30	6	7
α-helix	31-32	2
β-strand	40-44	5	7
β-strand	49-52	4	7
α-helix	57-68	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 3	A, B, C, D, E	protein	70	HOMO SAPIENS	P10147 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>2X69_1 C-C MOTIF CHEMOKINE 3 (chains A, B, C, D, E)
ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQ
KYVSDLELSA

Primary citation

Polymerization of Mip-1 Chemokine (Ccl3 and Ccl4) and Clearance of Mip-1 by Insulin-Degrading Enzyme. Ren, M., Guo, Q., Guo, L. et al. EMBO J (2010) 29:3952. DOI 10.1038/EMBOJ.2010.256 · PubMed

Other PDB entries of the same protein (UniProt P10147 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FPU 1.76 Å, The crystallographic structure of the Complex between Evasin-1 and CCL3
2X6G 2.18 Å, X-ray Structure of Macrophage Inflammatory Protein-1 alpha (D27A)
5COR 2.55 Å, X-ray structure of macrophage inflammatory protein-1 alpha (CCL3) N-terminal-switch…
4RA8 2.6 Å, Structure analysis of the Mip1a P8A mutant
7F1T 2.6 Å, Crystal structure of the human chemokine receptor CCR5 in complex with MIP-1a
3KBX 2.65 Å, Human macrophage inflammatory protein-1 alpha L3M_V63M
4ZKB 2.9 Å, The chemokine binding protein of orf virus complexed with CCL3
7F1Q 2.9 Å, Cryo-EM structure of the chemokine receptor CCR5 in complex with MIP-1a and Gi
3H44 3.0 Å, Crystal Structure of Insulin Degrading Enzyme in Complex with macrophage inflammatory…
5D65 3.1 Å, X-ray structure of macrophage inflammatory protein-1 alpha (CCL3) with heparin complex
1B50 NMR structure of human mip-1A D26A, 10 structures
1B53 NMR structure of human mip-1A D26A, minimized average structure

Browse structure collections

About this viewer

MolViewer shows 2X69 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.