4RA8: Structure analysis of the Mip1a P8A mutant

Structure analysis of the Mip1a P8A mutant. Determined by X-ray diffraction at 2.6 Å resolution. Released 24 Sept 2014.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 5
Atoms: 2,691
Mol. weight: 38.48 kDa
Released: 24 Sept 2014

Explore 4RA8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RA8 contains 26 α-helices and 19 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
α-helix	8-10	3
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	1
α-helix	31-32	2
β-strand	40-44	5	1
β-strand	49-52	4	1
α-helix	57-67	11

Chains B and D: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	9-11	3	2
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	3
α-helix	31-32	2
β-strand	40-44	5	3
β-strand	49-52	4	3
α-helix	57-67	11

Chains C and E: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	9-11	3	2
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	4
α-helix	31-32	2
β-strand	40-44	5	4
β-strand	49-52	4	4
α-helix	57-68	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 3	A, B, C, D, E	protein	69	Homo sapiens	P10147 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>4RA8_1 C-C motif chemokine 3 (chains A, B, C, D, E)
ASLAADTATACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQ
KYVSDLELS

Primary citation

Structures of human CCL18, CCL3, and CCL4 reveal molecular determinants for quaternary structures and sensitivity to insulin-degrading enzyme. Liang, W.G., Ren, M., Zhao, F. et al. J Mol Biol (2015) 427:1345-1358. DOI 10.1016/j.jmb.2015.01.012 · PubMed

Other PDB entries of the same protein (UniProt P10147 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3FPU 1.76 Å, The crystallographic structure of the Complex between Evasin-1 and CCL3
2X6G 2.18 Å, X-ray Structure of Macrophage Inflammatory Protein-1 alpha (D27A)
5COR 2.55 Å, X-ray structure of macrophage inflammatory protein-1 alpha (CCL3) N-terminal-switch…
7F1T 2.6 Å, Crystal structure of the human chemokine receptor CCR5 in complex with MIP-1a
2X69 2.65 Å, X-ray Structure of Macrophage Inflammatory Protein-1 alpha polymer
3KBX 2.65 Å, Human macrophage inflammatory protein-1 alpha L3M_V63M
4ZKB 2.9 Å, The chemokine binding protein of orf virus complexed with CCL3
7F1Q 2.9 Å, Cryo-EM structure of the chemokine receptor CCR5 in complex with MIP-1a and Gi
3H44 3.0 Å, Crystal Structure of Insulin Degrading Enzyme in Complex with macrophage inflammatory…
5D65 3.1 Å, X-ray structure of macrophage inflammatory protein-1 alpha (CCL3) with heparin complex
1B50 NMR structure of human mip-1A D26A, 10 structures
1B53 NMR structure of human mip-1A D26A, minimized average structure

Browse structure collections

About this viewer

MolViewer shows 4RA8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.