2X6G: Macrophage Inflammatory Protein-1 alpha
X-ray Structure of Macrophage Inflammatory Protein-1 alpha (D27A). Determined by X-ray diffraction at 2.18 Å resolution. Released 3 Nov 2010.
- Method
- X-ray diffraction
- Resolution
- 2.18 Å
- Organism
- HOMO SAPIENS
- Chains
- 18
- Atoms
- 9,591
- Mol. weight
- 139.49 kDa
- Released
- 3 Nov 2010
Explore 2X6G in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
2X6G contains 67 α-helices and 72 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, C, J and O: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 9-11 | 3 | 1 |
| α-helix | 19-21 | 3 | |
| α-helix | 22-24 | 3 | |
| β-strand | 25-30 | 6 | 2 |
| α-helix | 31-32 | 2 | |
| β-strand | 40-44 | 5 | 2 |
| β-strand | 49-52 | 4 | 2 |
| α-helix | 57-68 | 12 | |
Chain B: 3 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 9-11 | 3 | 1 |
| α-helix | 22-24 | 3 | |
| β-strand | 25-30 | 6 | 3 |
| α-helix | 31-32 | 2 | |
| β-strand | 40-44 | 5 | 3 |
| β-strand | 49-52 | 4 | 3 |
| α-helix | 57-67 | 11 | |
Chains D, I and N: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 9-11 | 3 | 4 |
| α-helix | 19-21 | 3 | |
| α-helix | 22-24 | 3 | |
| β-strand | 25-30 | 6 | 6 |
| α-helix | 31-32 | 2 | |
| β-strand | 40-44 | 5 | 6 |
| β-strand | 49-52 | 4 | 6 |
| α-helix | 57-67 | 11 | |
Chain E: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-8 | 2 | |
| β-strand | 9-11 | 3 | 7 |
| α-helix | 19-21 | 3 | |
| α-helix | 22-24 | 3 | |
| β-strand | 25-30 | 6 | 8 |
| α-helix | 31-32 | 2 | |
| β-strand | 40-44 | 5 | 8 |
| β-strand | 49-52 | 4 | 8 |
| α-helix | 57-67 | 11 | |
Chain F: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 9-11 | 3 | 7 |
| α-helix | 19-21 | 3 | |
| α-helix | 22-24 | 3 | |
| β-strand | 25-30 | 6 | 9 |
| α-helix | 31-32 | 2 | |
| β-strand | 40-44 | 5 | 9 |
| β-strand | 49-52 | 4 | 9 |
| α-helix | 57-69 | 13 | |
Chain G: 4 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 9-11 | 3 | 10 |
| α-helix | 19-21 | 3 | |
| α-helix | 22-24 | 3 | |
| β-strand | 25-30 | 6 | 11 |
| α-helix | 31-32 | 2 | |
| β-strand | 40-44 | 5 | 11 |
| β-strand | 49-50 | 2 | 11 |
| α-helix | 57-67 | 11 | |
Chain H: 5 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-8 | 2 | |
| β-strand | 9-11 | 3 | 10 |
| α-helix | 19-21 | 3 | |
| α-helix | 22-24 | 3 | |
| β-strand | 25-30 | 6 | 12 |
| α-helix | 31-32 | 2 | |
| β-strand | 40-44 | 5 | 12 |
| β-strand | 49-52 | 4 | 12 |
| α-helix | 57-65 | 9 | |
Chain K: 2 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 9-11 | 3 | 16 |
| α-helix | 22-24 | 3 | |
| β-strand | 25-30 | 6 | 17 |
| β-strand | 40-44 | 5 | 17 |
| β-strand | 49-52 | 4 | 17 |
| α-helix | 57-65 | 9 | |
5 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| C-C motif chemokine 3 | A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R | protein | 70 | HOMO SAPIENS | P10147 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R), FASTA
>2X6G_1 C-C MOTIF CHEMOKINE 3 (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R)
ASLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQ
KYVSDLELSA
Primary citation
Polymerization of Mip-1 Chemokine (Ccl3 and Ccl4) and Clearance of Mip-1 by Insulin-Degrading Enzyme. Ren, M., Guo, Q., Guo, L. et al. EMBO J (2010) 29:3952. DOI 10.1038/EMBOJ.2010.256 · PubMed
Other PDB entries of the same protein (UniProt P10147 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3FPU 1.76 Å, The crystallographic structure of the Complex between Evasin-1 and CCL3
- 5COR 2.55 Å, X-ray structure of macrophage inflammatory protein-1 alpha (CCL3) N-terminal-switch…
- 4RA8 2.6 Å, Structure analysis of the Mip1a P8A mutant
- 7F1T 2.6 Å, Crystal structure of the human chemokine receptor CCR5 in complex with MIP-1a
- 2X69 2.65 Å, X-ray Structure of Macrophage Inflammatory Protein-1 alpha polymer
- 3KBX 2.65 Å, Human macrophage inflammatory protein-1 alpha L3M_V63M
- 4ZKB 2.9 Å, The chemokine binding protein of orf virus complexed with CCL3
- 7F1Q 2.9 Å, Cryo-EM structure of the chemokine receptor CCR5 in complex with MIP-1a and Gi
- 3H44 3.0 Å, Crystal Structure of Insulin Degrading Enzyme in Complex with macrophage inflammatory…
- 5D65 3.1 Å, X-ray structure of macrophage inflammatory protein-1 alpha (CCL3) with heparin complex
- 1B50 NMR structure of human mip-1A D26A, 10 structures
- 1B53 NMR structure of human mip-1A D26A, minimized average structure
Browse structure collections
About this viewer
MolViewer shows 2X6G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.