1BJ8: GP130

Name: PDB 1BJ8: Third N-terminal domain of GP130, NMR, minimized average structure
Published: 1999-01-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: receptor

Third N-terminal domain of GP130, NMR, minimized average structure. Determined by solution NMR. Released 13 Jan 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 890
Mol. weight: 12.65 kDa
Released: 13 Jan 1999

Explore 1BJ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BJ8 contains 0 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	1
β-strand	24-27	4	1
β-strand	39-47	9	2
β-strand	56	1	2
β-strand	67-70	4	1
β-strand	78-87	10	2
β-strand	99-104	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GP130	A	protein	109	Homo sapiens	P40189 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BJ8_1 GP130 (chains A)
MDKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPED
TASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDR

Primary citation

The signal transducer gp130: solution structure of the carboxy-terminal domain of the cytokine receptor homology region. Kernebeck, T., Pflanz, S., Muller-Newen, G. et al. Protein Sci (1999) 8:5-12. PubMed

Other PDB entries of the same protein (UniProt P40189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L5I 1.9 Å, Crystal structure of FnIII domains of human GP130 (Domains 4-6)
1BQU 2.0 Å, Cytokyne-binding region of GP130
1I1R 2.4 Å, Crystal structure of a cytokine/receptor complex
1PVH 2.5 Å, Crystal structure of leukemia inhibitory factor in complex with gp130
8D74 3.03 Å, Cryo-EM structure of human CNTF signaling complex: model containing the interaction core…
3L5J 3.04 Å, Crystal structure of FnIII domains of human GP130 (Domains 4-6)
8D82 3.22 Å, Cryo-EM structure of human IL-6 signaling complex in detergent: model containing full…
8UPA 3.3 Å, Structure of gp130 in complex with a de novo designed IL-6 mimetic
7U7N 3.47 Å, IL-27 quaternary receptor signaling complex
8DPS 3.47 Å, The structure of the interleukin 11 signalling complex, truncated gp130
8D6A 3.54 Å, Cryo-EM structure of human LIF signaling complex: model containing the interaction core…
8V2A 3.59 Å, Cryo-EM structure of human type I OSM receptor complex: model for assembly core region

Browse structure collections

About this viewer

MolViewer shows 1BJ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.