3L5I: FnIII domains of human GP130

Crystal structure of FnIII domains of human GP130 (Domains 4-6). Determined by X-ray diffraction at 1.9 Å resolution. Released 12 May 2010.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,549
Mol. weight: 34.25 kDa
Released: 12 May 2010

Explore 3L5I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3L5I contains 8 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	307-309	3
β-strand	310-316	7	1
β-strand	323-329	7	1
α-helix	331-333	3
α-helix	334-337	4
β-strand	341-350	10	2
β-strand	356-360	5	2
β-strand	364-369	6	1
β-strand	374-382	9	2
β-strand	386	1	2
α-helix	387-389	3
β-strand	390-394	5	2
β-strand	406-413	8	3
β-strand	416-422	7	3
α-helix	423-424	2
β-strand	430-438	9	4
β-strand	447-452	6	4
β-strand	457-459	3	3
β-strand	469-478	10	4
β-strand	481-482	2	4
β-strand	486-491	6	4
β-strand	503-508	6	5
β-strand	513-517	5	5
α-helix	518-521	4
α-helix	522-525	4
β-strand	531-538	8	6
β-strand	544-549	6	6
β-strand	554-557	4	5
α-helix	560-561	2
β-strand	565-574	10	6
β-strand	577-580	4	6
β-strand	584-587	4	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-6 receptor subunit beta	A	protein	290	Homo sapiens	P40189 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3L5I_1 Interleukin-6 receptor subunit beta (chains A)
EDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTV
NATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVE
WTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYAD
GPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTII
GNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPK

Primary citation

Crystal structure of the entire ectodomain of gp130: insights into the molecular assembly of the tall cytokine receptor complexes. Xu, Y., Kershaw, N.J., Luo, C.S. et al. J Biol Chem (2010) 285:21214-21218. DOI 10.1074/jbc.C110.129502 · PubMed

Other PDB entries of the same protein (UniProt P40189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1BQU 2.0 Å, Cytokyne-binding region of GP130
1I1R 2.4 Å, Crystal structure of a cytokine/receptor complex
1PVH 2.5 Å, Crystal structure of leukemia inhibitory factor in complex with gp130
8D74 3.03 Å, Cryo-EM structure of human CNTF signaling complex: model containing the interaction core…
3L5J 3.04 Å, Crystal structure of FnIII domains of human GP130 (Domains 4-6)
8D82 3.22 Å, Cryo-EM structure of human IL-6 signaling complex in detergent: model containing full…
8UPA 3.3 Å, Structure of gp130 in complex with a de novo designed IL-6 mimetic
7U7N 3.47 Å, IL-27 quaternary receptor signaling complex
8DPS 3.47 Å, The structure of the interleukin 11 signalling complex, truncated gp130
8D6A 3.54 Å, Cryo-EM structure of human LIF signaling complex: model containing the interaction core…
8V2A 3.59 Å, Cryo-EM structure of human type I OSM receptor complex: model for assembly core region
3L5H 3.6 Å, Crystal structure of the full ectodomain of human gp130: New insights into the molecular…

Browse structure collections

About this viewer

MolViewer shows 3L5I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.