1BY5: Fhua from E. Coli, with its ligand ferrichrome

Fhua from E. Coli, with its ligand ferrichrome. Determined by X-ray diffraction at 2.6 Å resolution. Released 13 Jan 1999.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Escherichia coli, Ustilago sphaerogena
Chains: 2
Atoms: 5,749
Mol. weight: 81.34 kDa
Ligands: OES, FE
Released: 13 Jan 1999

Explore 1BY5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BY5 contains 11 α-helices and 44 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 44 β-strands

Element	Residues	Length	Sheet
β-strand	32-33	2	1
β-strand	41-42	2	1
α-helix	43-45	3
β-strand	50-54	5	2
α-helix	55-61	7
α-helix	66-69	4
β-strand	76-77	2	3
β-strand	91-92	2	3
β-strand	95	1	3
β-strand	104-106	3	2
β-strand	109-110	2	2
β-strand	114	1	4
β-strand	117	1	4
α-helix	123-125	3
β-strand	126-133	8	2
α-helix	137-140	4
β-strand	147-153	7	2
β-strand	161-169	9	5
β-strand	173-183	11	5
β-strand	190-202	13	5
β-strand	209-221	13	5
β-strand	227-240	14	5
β-strand	247	1	6
β-strand	250	1	7
β-strand	254	1	7
β-strand	274-289	16	5
β-strand	294-317	24	5
α-helix	321-323	3
α-helix	327-330	4
α-helix	334-338	5
β-strand	340-367	28	5
β-strand	370-392	23	5
β-strand	397-401	5	5
β-strand	420-442	23	5
β-strand	445-462	18	5
β-strand	468-484	17	5
β-strand	490-501	12	5
β-strand	506	1	8
β-strand	512	1	8
α-helix	513-515	3
β-strand	516-527	12	5
β-strand	535-551	17	5
β-strand	559-576	18	5
β-strand	582-597	16	5
β-strand	612-621	10	5
β-strand	630-639	10	5
β-strand	642-643	2	9
β-strand	651-652	2	9
α-helix	653-654	2
β-strand	655-665	11	5
β-strand	675-681	7	5
β-strand	689-694	6	6
β-strand	697-700	4	6
α-helix	701-703	3
β-strand	705-713	9	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferric hydroxamate uptake protein	A	protein	714	Escherichia coli	P06971 (AlphaFold model)
Ferrichrome	B	protein	6	Ustilago sphaerogena

Sequence of entity 1 (A), FASTA

>1BY5_1 FERRIC HYDROXAMATE UPTAKE PROTEIN (chains A)
AVEPKEDTITVTAAPAPQESAWGPAATIAARQSATGTKTDTPIQKVPQSISVVTAEEMAL
HQPKSVKEALSYTPGVSVGTRGASNTYDHLIIRGFAAEGQSQNNYLNGLKLQGNFYNDAV
IDPYMLERAEIMRGPVSVLYGKSSPGGLLNMVSKRPTTEPLKEVQFKAGTDSLFQTGFDF
SDSLDDDGVYSYRLTGLARSANAQQKGSEEQRYAIAPAFTWRPDDKTNFTFLSYFQNEPE
TGYYGWLPKEGTVEPLPNGKRLPTDFNEGAKNNTYSRNEKMVGYSFDHEFNDTFTVRQNL
RFAENKTSQNSVYGYGVCSDPANAYSKQCAALAPADKGHYLARKYVVDDEKLQNFSVDTQ
LQSKFATGDIDHTLLTGVDFMRMRNDINAWFGYDDSVPLLNLYNPVNTDFDFNAKDPANS
GPYRILNKQKQTGVYVQDQAQWDKVLVTLGGRYDWADQESLNRVAGTTDKRDDKQFTWRG
GVNYLFDNGVTPYFSYSESFEPSSQVGKDGNIFAPSKGKQYEVGVKYVPEDRPIVVTGAV
YNLTKTNNLMADPEGSFFSVEGGEIRARGVEIEAKRPLSASVNVVGSYTYTDAEYTTDTT
YKGNTPAQVPKHMASLWADYTFFDGPLSGLTLGTGGRYTGSSYGDPANSFKVGSYTVVDA
LVRYDLARVGMAGSNVALHVNNLFDREYVASCFNTYGCFWGAERQVVATATFRF

Sequence of entity 2 (B), FASTA

>1BY5_2 FERRICHROME (chains B)
AAAGGG

Ligands and cofactors

ID	Name	Formula	Copies
OES	N-octyl-2-hydroxyethyl sulfoxide	C10 H22 O2 S	8
FE	FE (III) ion	Fe	1

Primary citation

Transmembrane signaling across the ligand-gated FhuA receptor: crystal structures of free and ferrichrome-bound states reveal allosteric changes. Locher, K.P., Rees, B., Koebnik, R. et al. Cell (1998) 95:771-778. DOI 10.1016/S0092-8674(00)81700-6 · PubMed

Other PDB entries of the same protein (UniProt P06971 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CU4 2.3 Å, FhuA from E. coli in complex with the lasso peptide microcin J25 (MccJ25)
1QFG 2.5 Å, E. Coli ferric hydroxamate receptor (FHUA)
2FCP 2.5 Å, Ferric hydroxamate uptake receptor (FHUA) from e.coli
8B14 2.6 Å, T5 Receptor Binding Protein pb5 in complex with its E. coli receptor FhuA
1FCP 2.7 Å, Ferric hydroxamate uptake receptor (FHUA) from e.coli in complex with bound…
1QFF 2.7 Å, E. Coli ferric hydroxamate uptake receptor (FHUA) in complex with bound ferrichrome-iron
1BY3 2.74 Å, Fhua from E. Coli
1FI1 2.9 Å, FhuA in complex with lipopolysaccharide and rifamycin CGP4832
1QJQ 2.95 Å, Ferric hydroxamate receptor from escherichia coli (FHUA)
1QKC 3.1 Å, Escherichia coli ferric hydroxamate uptake receptor (FHUA) in complex delta two-albomycin
8A8C 3.1 Å, T5 phage receptor-binding protein pb5 bound to ferrichrome transporter FhuA
2GRX 3.3 Å, Crystal structure of TonB in complex with FhuA, E. coli outer membrane receptor for…

Browse structure collections

About this viewer

MolViewer shows 1BY5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.