1EQT: Met-rantes

Met-rantes. Determined by X-ray diffraction at 1.6 Å resolution. Released 19 Apr 2000.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,281
Mol. weight: 15.96 kDa
Released: 19 Apr 2000

Explore 1EQT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EQT contains 8 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	1
β-strand	8-10	3	2
α-helix	18-20	3
α-helix	21-23	3
β-strand	24-29	6	3
α-helix	30-31	2
β-strand	39-43	5	3
β-strand	48-51	4	3
α-helix	56-66	11

Chain B: 4 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	2
α-helix	18-20	3
α-helix	21-23	3
β-strand	24-29	6	1
α-helix	30-31	2
β-strand	39-43	5	1
β-strand	48-51	4	1
α-helix	56-67	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-cell specific rantes protein	A, B	protein	68	Homo sapiens	P13501 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1EQT_1 T-CELL SPECIFIC RANTES PROTEIN (chains A, B)
MGYSSDTTPCCFAYIARPMPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVRE
YINSLEMS

Primary citation

The Crystal Structure of MET-RANTES: Comparison with Native RANTES and AOP-RANTES. Hoover, D.M., Shaw, J., Gryczynski, Z. et al. Protein Pept Lett (2000) 7:73-82. PubMed

Other PDB entries of the same protein (UniProt P13501 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5COY 1.44 Å, Crystal structure of CC chemokine 5 (CCL5)
6STK 1.52 Å, Crystal structure of the CC-chemokine 5 (CCL5) E66S mutation
1B3A 1.6 Å, Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV…
6AEZ 1.63 Å, Crystal structure of human CCL5 trimer
1U4P 1.7 Å, Crystal Structure of human RANTES mutant K45E
2VXW 1.7 Å, Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES
1U4L 2.0 Å, human RANTES complexed to heparin-derived disaccharide I-S
1U4M 2.0 Å, human RANTES complexed to heparin-derived disaccharide III-S
1U4R 2.2 Å, Crystal Structure of human RANTES mutant 44-AANA-47
5UIW 2.2 Å, Crystal Structure of CC Chemokine Receptor 5 (CCR5) in complex with high potency HIV…
5L2U 2.28 Å, Oligomer crystal structure of CC chemokine 5 (CCL5)
5DNF 2.55 Å, Crystal structure of CC chemokine 5 (CCL5) oligomer in complex with heparin

Browse structure collections

About this viewer

MolViewer shows 1EQT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.