Solution structure of the N-terminal zinc finger of murine gata-1, NMR, 25 structures. Determined by solution NMR. Released 8 Jun 1999.
Explore 1GNF in 3D Show helices and sheets RCSB PDB PDBe
1GNF contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 216 | 1 | 1 |
| β-strand | 224 | 1 | 1 |
| α-helix | 227-234 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcription factor gata-1 | A | protein | 46 | Mus musculus | P17679 (AlphaFold model) |
>1GNF_1 TRANSCRIPTION FACTOR GATA-1 (chains A) GSEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIR
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
The solution structure of the N-terminal zinc finger of GATA-1 reveals a specific binding face for the transcriptional co-factor FOG. Kowalski, K., Czolij, R., King, G.F. et al. J Biomol NMR (1999) 13:249-262. DOI 10.1023/A:1008309602929 · PubMed
Other PDB entries of the same protein (UniProt P17679 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1GNF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.