3VEK: Both Zn Fingers of GATA1

Both Zn Fingers of GATA1 Bound to Palindromic DNA Recognition Site, P1 Crystal Form. Determined by X-ray diffraction at 2.63 Å resolution. Released 16 Jan 2013.

Method: X-ray diffraction
Resolution: 2.63 Å
Organisms: synthetic construct, Mus musculus
Chains: 6
Atoms: 3,154
Mol. weight: 52.46 kDa
Ligands: ZN
Released: 16 Jan 2013

Explore 3VEK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VEK contains 12 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains C and F: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	216-217	2	1
β-strand	223-224	2	1
α-helix	226-235	10
α-helix	238-240	3
β-strand	270-271	2	2
β-strand	277-278	2	2
α-helix	280-289	10
α-helix	292-294	3
α-helix	295-297	3
α-helix	298-299	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(tptpgptpcptptpaptpcpapgpaptpgpgpapcptpc)-3')	A, D	DNA	20	synthetic construct
DNA (5'-d(apapgpapgptpcpcpaptpcptpgpaptpapapgpapc)-3')	B, E	DNA	20	synthetic construct
Erythroid transcription factor	C, F	protein	119	Mus musculus	P17679 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>3VEK_1 DNA (5'-D(*TP*TP*GP*TP*CP*TP*TP*AP*TP*CP*AP*GP*AP*TP*GP*GP*AP*CP*TP*C)-3') (chains A, D)
TTGTCTTATCAGATGGACTC

Sequence of entity 2 (B, E), FASTA

>3VEK_2 DNA (5'-D(*AP*AP*GP*AP*GP*TP*CP*CP*AP*TP*CP*TP*GP*AP*TP*AP*AP*GP*AP*C)-3') (chains B, E)
AAGAGTCCATCTGATAAGAC

Sequence of entity 3 (C, F), FASTA

>3VEK_3 Erythroid transcription factor (chains C, F)
EARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRMIVSKRAGTQCT
NCQTTTTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	14

Primary citation

GATA1 directly mediates interactions with closely spaced pseudopalindromic but not distantly spaced double GATA sites on DNA. Wilkinson-White, L., Lester, K.L., Ripin, N. et al. Protein Sci (2015) 24:1649-1659. DOI 10.1002/pro.2760 · PubMed

Other PDB entries of the same protein (UniProt P17679 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3VD6 1.98 Å, Both Zn Fingers of GATA1 Bound to Palindromic DNA Recognition Site, P21 Crystal Form
1GNF Solution structure of the N-terminal zinc finger of murine gata-1, NMR, 25 structures
1Y0J Zinc fingers as protein recognition motifs: structural basis for the GATA-1/Friend of…
2L5E Complex between BD1 of Brd3 and GATA-1 C-tail
2L6Y haddock model of GATA1NF:Lmo2LIM2-Ldb1LID
2L6Z haddock model of GATA1NF:Lmo2LIM2-Ldb1LID with FOG

Browse structure collections

About this viewer

MolViewer shows 3VEK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.