Both Zn Fingers of GATA1 Bound to Palindromic DNA Recognition Site, P21 Crystal Form. Determined by X-ray diffraction at 1.98 Å resolution. Released 16 Jan 2013.
Explore 3VD6 in 3D Show helices and sheets RCSB PDB PDBe
3VD6 contains 6 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 216-217 | 2 | 1 |
| β-strand | 223-224 | 2 | 1 |
| α-helix | 226-235 | 10 | |
| α-helix | 238-240 | 3 | |
| β-strand | 270-271 | 2 | 2 |
| β-strand | 277-278 | 2 | 2 |
| α-helix | 280-289 | 10 | |
| α-helix | 292-294 | 3 | |
| α-helix | 295-297 | 3 | |
| α-helix | 307-309 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA (5'-d(*tp*tp*gp*tp*cp*tp*tp*ap*tp*cp*ap*gp*ap*tp*gp*gp*ap*cp*tp*c)-3') | A | DNA | 20 | synthetic construct | |
| DNA (5'-d(*ap*ap*gp*ap*gp*tp*cp*cp*ap*tp*cp*tp*gp*ap*tp*ap*ap*gp*ap*c)-3') | B | DNA | 20 | synthetic construct | |
| Erythroid transcription factor | C | protein | 119 | Mus musculus | P17679 (AlphaFold model) |
>3VD6_1 DNA (5'-D(*TP*TP*GP*TP*CP*TP*TP*AP*TP*CP*AP*GP*AP*TP*GP*GP*AP*CP*TP*C)-3') (chains A) TTGTCTTATCAGATGGACTC
>3VD6_2 DNA (5'-D(*AP*AP*GP*AP*GP*TP*CP*CP*AP*TP*CP*TP*GP*AP*TP*AP*AP*GP*AP*C)-3') (chains B) AAGAGTCCATCTGATAAGAC
>3VD6_3 Erythroid transcription factor (chains C) EARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRPLIRPKKRMIVSKRAGTQCT NCQTTTTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKDGIQTRNRKASGKGKKKRG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Water and common crystallization additives (ACT) are not listed.
GATA1 directly mediates interactions with closely spaced pseudopalindromic but not distantly spaced double GATA sites on DNA. Wilkinson-White, L., Lester, K.L., Ripin, N. et al. Protein Sci (2015) 24:1649-1659. DOI 10.1002/pro.2760 · PubMed
Other PDB entries of the same protein (UniProt P17679 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3VD6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.