High-resolution three-dimensional structure of horse heart cytochrome C. Determined by X-ray diffraction at 1.9 Å resolution. Released 1 Nov 1994.
Explore 1HRC in 3D Show helices and sheets RCSB PDB PDBe
1HRC contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-13 | 11 | |
| α-helix | 24-26 | 3 | |
| β-strand | 39 | 1 | 1 |
| α-helix | 50-54 | 5 | |
| β-strand | 58 | 1 | 1 |
| α-helix | 61-67 | 7 | |
| α-helix | 71-74 | 4 | |
| α-helix | 88-103 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytochrome C | A | protein | 105 | Equus caballus | P00004 (AlphaFold model) |
>1HRC_1 CYTOCHROME C (chains A) XGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFTYTDANKNKGITW KEETLMEYLENPKKYIPGTKMIFAGIKKKTEREDLIAYLKKATNE
| ID | Name | Formula | Copies |
|---|---|---|---|
| HEC | Heme C | C34 H36 Fe N4 O4 | 1 |
High-resolution three-dimensional structure of horse heart cytochrome c. Bushnell, G.W., Louie, G.V., Brayer, G.D. J Mol Biol (1990) 214:585-595. DOI 10.1016/0022-2836(90)90200-6 · PubMed
Other PDB entries of the same protein (UniProt P00004 (AlphaFold model), which also has an AlphaFold model), best resolution first:
1HRC is part of these collections:
MolViewer shows 1HRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.