1M12: Human Saposin C

NMR solution structure of human Saposin C. Determined by solution NMR. Released 29 Jul 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 653
Mol. weight: 9.42 kDa
Released: 29 Jul 2003

Explore 1M12 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1M12 contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	3-20	18
α-helix	25-31	7
α-helix	36-38	3
α-helix	44-62	19
α-helix	69-74	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Saposin C	A	protein	84	Homo sapiens	P07602 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1M12_1 SAPOSIN C (chains A)
SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILS
ILLEEVSPELVCSMLHLCSGLVPR

Primary citation

Solution structure of human saposin C: pH-dependent interaction with phospholipid vesicles. de Alba, E., Weiler, S., Tjandra, N. Biochemistry (2003) 42:14729-14740. DOI 10.1021/bi0301338 · PubMed

Other PDB entries of the same protein (UniProt P07602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BQP 1.3 Å, Crystal Structure of Human Saposin D (orthorhombic)
9I63 1.65 Å, Synthetic Human Saposin D glycoprotein
4UEX 1.8 Å, Structure of human Saposin A at lysosomal pH
4DDJ 1.9 Å, Crystal structure of saposin A in complex with lauryldimethylamine-N-oxide (LDAO)
2DOB 2.0 Å, Crystal Structure of Human Saposin A
3BQQ 2.0 Å, Crystal Structure of Human Saposin D (triclinic)
2RB3 2.1 Å, Crystal Structure of Human Saposin D
4V2O 2.13 Å, Structure of saposin B in complex with chloroquine
1N69 2.2 Å, Crystal structure of human saposin B
6SLR 2.38 Å, Structure of saposin B in complex with atovaquone
2GTG 2.4 Å, Crystal Structure of Human Saposin C
2QYP 2.45 Å, Orthorhombic Crystal Structure of Human Saposin C Dimer in Open Conformation

Browse structure collections

About this viewer

MolViewer shows 1M12 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.