1N7T: ERBIN PDZ domain

ERBIN PDZ domain bound to a phage-derived peptide. Determined by solution NMR. Released 28 Jan 2003.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 852
Mol. weight: 12.07 kDa
Released: 28 Jan 2003

Explore 1N7T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1N7T contains 2 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
β-strand	25	1	2
β-strand	26-27	2	3
β-strand	28-29	2	1
β-strand	35	1	1
β-strand	45-46	2	1
β-strand	50	1	2
α-helix	64	1
β-strand	65-69	5	1
β-strand	72-73	2	1
α-helix	79-88	10
β-strand	92-98	7	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	305-306	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
99-mer peptide of densin-180-like protein	A	protein	103	Homo sapiens	Q96RT1 (AlphaFold model)
phage-derived peptide	B	protein	7

Sequence of entity 1 (A), FASTA

>1N7T_1 99-mer peptide of densin-180-like protein (chains A)
GSHMGHELAKQEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLL
QPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS

Sequence of entity 2 (B), FASTA

>1N7T_2 phage-derived peptide (chains B)
TGWETWV

Primary citation

Origins of PDZ domain ligand specificity. Structure determination and mutagenesis of the Erbin PDZ domain. Skelton, N.J., Koehler, M.F.T., Zobel, K. et al. J Biol Chem (2003) 278:7645-7654. DOI 10.1074/jbc.M209751200 · PubMed

Other PDB entries of the same protein (UniProt Q96RT1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2H3L 1.0 Å, Crystal Structure of ERBIN PDZ
6Q0N 1.18 Å, Structure of the Erbin PDB domain in complex with a high-affinity peptide
6Q0M 1.2 Å, Structure of Erbin PDZ derivative E-14 with a high-affinity peptide
1MFG 1.25 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
7LUL 1.65 Å, Structure of the MM2 Erbin PDZ variant in complex with a high-affinity peptide
2QBW 1.8 Å, The crystal structure of PDZ-Fibronectin fusion protein
6UBH 1.8 Å, Structure of the MM7 Erbin PDZ variant in complex with a high-affinity peptide
1MFL 1.88 Å, The Structure of ERBIN PDZ domain bound to the Carboxy-terminal tail of the ErbB2 Receptor
6Q0U 1.89 Å, Structure of the Erbin PDZ variant E-6a with a high-affinity C-terminal peptide
3CH8 1.9 Å, The crystal structure of PDZ-Fibronectin fusion protein

Browse structure collections

About this viewer

MolViewer shows 1N7T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.