1OC0: Plasminogen activator inhibitor-1

plasminogen activator inhibitor-1 complex with somatomedin B domain of vitronectin. Determined by X-ray diffraction at 2.28 Å resolution. Released 19 Jun 2003.

Method: X-ray diffraction
Resolution: 2.28 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 3,324
Mol. weight: 48.61 kDa
Released: 19 Jun 2003

Explore 1OC0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OC0 contains 17 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	7-25	19
β-strand	32-34	3	1
α-helix	36-49	14
α-helix	52-62	11
α-helix	71-82	12
β-strand	91-100	10	2
α-helix	104-106	3
α-helix	109-117	9
β-strand	122-124	3	2
α-helix	129-142	14
β-strand	163-172	10	2
α-helix	173-174	2
β-strand	175	1	3
α-helix	178-180	3
α-helix	181-183	3
β-strand	185-190	6	4
β-strand	196-208	13	4
β-strand	210-214	5	1
β-strand	220-227	8	1
β-strand	228	1	3
α-helix	229-231	3
β-strand	233-240	8	1
α-helix	248-251	4
α-helix	256-260	5
β-strand	269-276	8	4
β-strand	278-285	8	2
α-helix	287-292	6
α-helix	297-299	3
β-strand	319-328	10	2
β-strand	351-353	3	4
β-strand	358-364	7	1
β-strand	369-376	8	1

Chain B: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	20	1	5
α-helix	25-28	4
β-strand	31	1	5
α-helix	35-38	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Plasminogen activator inhibitor-1	A	protein	379	HOMO SAPIENS	P05121 (AlphaFold model)
Vitronectin	B	protein	51	HOMO SAPIENS	P04004 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1OC0_1 PLASMINOGEN ACTIVATOR INHIBITOR-1 (chains A)
VHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQA
AMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRST
VKQVDFSEVERARFIINDWVKTHTKGMISHLLGTGAVDQLTRLVLVNALYFNGQWKTPFP
DSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAP
YEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFR
QFQADFTSLSDQEPLHVALALQKVKIEVNESGTVASSSTAVIVSARMAPEEIIIDRPFLF
VVRHNPTGTVLFMGQVMEP

Sequence of entity 2 (B), FASTA

>1OC0_2 VITRONECTIN (chains B)
DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTM

Primary citation

How Vitronectin Binds Pai-1 to Modulate Fibrinolysis and Cell Migration. Zhou, A., Huntington, J.A., Pannu, N.S. et al. Nat Struct Biol (2003) 10:541. DOI 10.1038/NSB943 · PubMed

Other PDB entries of the same protein (UniProt P05121 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7AQF 1.77 Å, Crystal Structure of Small Molecule Inhibitor TM5484 Bound to Stabilized Active…
1LJ5 1.8 Å, 1.8A Resolution Structure of Latent Plasminogen Activator Inhibitor-1(PAI-1)
6ZRV 1.88 Å, Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-W175F)…
1A7C 1.95 Å, Human plasminogen activator inhibitor type-1 in complex with a pentapeptide
3CVM 2.02 Å, High resolution structure of a stable Plasminogen activator inhibitor type-1 in its…
6GWN 2.03 Å, Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-W175F)…
1DVN 2.1 Å, Latent form of plasminogen activator inhibitor-1 (pai-1)
4G8R 2.19 Å, Crystal Structure of a novel small molecule inactivator bound to plasminogen activator…
7AQG 2.27 Å, Crystal Structure of Small Molecule Inhibitor TM5484 Bound to Stabilized Active…
6GWP 2.28 Å, Crystal Structure of Stabilized Active Plasminogen Activator Inhibitor-1 (PAI-1-stab) in…
3PB1 2.3 Å, Crystal Structure of a Michaelis Complex between Plasminogen Activator Inhibitor-1 and…
3Q02 2.3 Å, Crystal structure of plasminogen activator inhibitor-1 in a metastable active…

Browse structure collections

About this viewer

MolViewer shows 1OC0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.