1PDR: Human discs large protein

Crystal structure of the third PDZ domain from the human homolog of discs large protein. Determined by X-ray diffraction at 2.8 Å resolution. Released 23 Jul 1997.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 727
Mol. weight: 10.56 kDa
Released: 23 Jul 1997

Explore 1PDR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1PDR contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	465-470	6	1
β-strand	478-482	5	1
β-strand	489-494	6	1
α-helix	495	1
α-helix	499-503	5
β-strand	510-515	6	1
β-strand	518-519	2	1
α-helix	525-533	9
β-strand	538-545	8	1
α-helix	547-554	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human discs large protein	A	protein	99	Homo sapiens	Q12959 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1PDR_1 HUMAN DISCS LARGE PROTEIN (chains A)
DDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVN
SVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRQHA

Primary citation

Crystal structure of a PDZ domain. Morais Cabral, J.H., Petosa, C., Sutcliffe, M.J. et al. Nature (1996) 382:649-652. DOI 10.1038/382649a0 · PubMed

Other PDB entries of the same protein (UniProt Q12959 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
2X7Z 2.0 Å, Crystal Structure of the SAP97 PDZ2 I342W C378A mutant protein domain
4G69 2.0 Å, Structure of the Human Discs Large 1 PDZ2 - Adenomatous Polyposis Coli Cytoskeletal…
8CN1 2.09 Å, hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1
3RL8 2.2 Å, Crystal structure of hDLG1-PDZ2 complexed with APC
3W9Y 2.2 Å, Crystal structure of the human DLG1 guanylate kinase domain
3RL7 2.3 Å, Crystal structure of hDLG1-PDZ1 complexed with APC
4AMH 2.3 Å, Influence of circular permutation on the folding pathway of a PDZ domain
8CN3 2.71 Å, hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1
3LRA 2.95 Å, Structural Basis for Assembling a Human Tripartite Complex Dlg1-MPP7-Mals3
2M3M Solution structure of a complex consisting of hDlg/SAP-97 residues 318-406 and HPV51…
2OQS Structure of the hDLG/SAP97 PDZ2 in complex with HPV-18 papillomavirus E6 peptide

Browse structure collections

About this viewer

MolViewer shows 1PDR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.