4AMH: Disks large homolog 1

Influence of circular permutation on the folding pathway of a PDZ domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 5 Dec 2012.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 1,453
Mol. weight: 22.96 kDa
Released: 5 Dec 2012

Explore 4AMH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4AMH contains 5 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	1
β-strand	28	1	2
β-strand	31	1	2
β-strand	34-39	6	1
α-helix	44-48	5
β-strand	56-60	5	1
β-strand	63-64	2	1
α-helix	70-78	9
β-strand	83-89	7	1
β-strand	97-103	7	1

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	17-21	5	3
β-strand	28	1	4
β-strand	31	1	4
β-strand	34-39	6	3
α-helix	44-48	5
α-helix	55	1
β-strand	56-60	5	3
β-strand	63-64	2	3
α-helix	70-78	9
β-strand	83-89	7	3
β-strand	98-103	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 1	A, B	protein	106	HOMO SAPIENS	Q12959 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4AMH_1 DISKS LARGE HOMOLOG 1 (chains A, B)
MHHHHHLVPRGSKGLGFSIAGGVGNQHWPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAV
NNVALEEVTHEEAVTALKNTSDFVYLKVAKPGSGEKIMEIKLIKGP

Primary citation

Tolerance of Protein Folding to a Circular Permutation in a Pdz Domain. Hultqvist, G., Punekar, A.S., Morrone, A. et al. PLoS One (2012) 7:50055. DOI 10.1371/JOURNAL.PONE.0050055 · PubMed

Other PDB entries of the same protein (UniProt Q12959 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
2X7Z 2.0 Å, Crystal Structure of the SAP97 PDZ2 I342W C378A mutant protein domain
4G69 2.0 Å, Structure of the Human Discs Large 1 PDZ2 - Adenomatous Polyposis Coli Cytoskeletal…
8CN1 2.09 Å, hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1
3RL8 2.2 Å, Crystal structure of hDLG1-PDZ2 complexed with APC
3W9Y 2.2 Å, Crystal structure of the human DLG1 guanylate kinase domain
3RL7 2.3 Å, Crystal structure of hDLG1-PDZ1 complexed with APC
8CN3 2.71 Å, hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1
1PDR 2.8 Å, Crystal structure of the third PDZ domain from the human homolog of discs large protein
3LRA 2.95 Å, Structural Basis for Assembling a Human Tripartite Complex Dlg1-MPP7-Mals3
2M3M Solution structure of a complex consisting of hDlg/SAP-97 residues 318-406 and HPV51…
2OQS Structure of the hDLG/SAP97 PDZ2 in complex with HPV-18 papillomavirus E6 peptide

Browse structure collections

About this viewer

MolViewer shows 4AMH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.