2OQS: HDLG/SAP97 PDZ2

Structure of the hDLG/SAP97 PDZ2 in complex with HPV-18 papillomavirus E6 peptide. Determined by solution NMR. Released 4 Sept 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 736
Mol. weight: 11.19 kDa
Released: 4 Sept 2007

Explore 2OQS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2OQS contains 4 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	7	1
β-strand	14	1	2
β-strand	15-17	3	1
β-strand	25	1	3
β-strand	28	1	3
β-strand	31-32	2	1
β-strand	36	1	2
α-helix	37	1
α-helix	41-45	5
β-strand	53-57	5	1
β-strand	60-61	2	1
α-helix	67-75	9
β-strand	80-86	7	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	303-305	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 1	A	protein	97	Homo sapiens	Q12959 (AlphaFold model)
C-terminal HPV-18 E6 peptide	B	protein	6

Sequence of entity 1 (A), FASTA

>2OQS_1 Disks large homolog 1 (chains A)
MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNV
CLEEVTHEEAVTALKNTSDFVYLKVAKPTGSHHHHHH

Sequence of entity 2 (B), FASTA

>2OQS_2 C-terminal HPV-18 E6 peptide (chains B)
RRETQV

Primary citation

Solution structure of the hDlg/SAP97 PDZ2 domain and its mechanism of interaction with HPV-18 papillomavirus E6 protein. Liu, Y., Henry, G.D., Hegde, R.S. et al. Biochemistry (2007) 46:10864-10874. DOI 10.1021/bi700879k · PubMed

Other PDB entries of the same protein (UniProt Q12959 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
2X7Z 2.0 Å, Crystal Structure of the SAP97 PDZ2 I342W C378A mutant protein domain
4G69 2.0 Å, Structure of the Human Discs Large 1 PDZ2 - Adenomatous Polyposis Coli Cytoskeletal…
8CN1 2.09 Å, hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1
3RL8 2.2 Å, Crystal structure of hDLG1-PDZ2 complexed with APC
3W9Y 2.2 Å, Crystal structure of the human DLG1 guanylate kinase domain
3RL7 2.3 Å, Crystal structure of hDLG1-PDZ1 complexed with APC
4AMH 2.3 Å, Influence of circular permutation on the folding pathway of a PDZ domain
8CN3 2.71 Å, hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1
1PDR 2.8 Å, Crystal structure of the third PDZ domain from the human homolog of discs large protein
3LRA 2.95 Å, Structural Basis for Assembling a Human Tripartite Complex Dlg1-MPP7-Mals3
2M3M Solution structure of a complex consisting of hDlg/SAP-97 residues 318-406 and HPV51…

Browse structure collections

About this viewer

MolViewer shows 2OQS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.