3W9Y: Human DLG1 guanylate kinase domain

Crystal structure of the human DLG1 guanylate kinase domain. Determined by X-ray diffraction at 2.2 Å resolution. Released 26 Jun 2013.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,495
Mol. weight: 23.4 kDa
Released: 26 Jun 2013

Explore 3W9Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3W9Y contains 9 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	739-742	4	1
α-helix	746-756	11
β-strand	761-762	2	2
β-strand	767-768	2	3
α-helix	771-773	3
β-strand	778	1	4
β-strand	782	1	4
β-strand	783-784	2	3
α-helix	788-796	9
β-strand	800-806	7	3
β-strand	809-814	6	3
α-helix	815-822	8
β-strand	827-828	2	2
β-strand	829-830	2	1
α-helix	835-842	8
β-strand	848-852	5	1
α-helix	877-886	10
α-helix	887-889	3
β-strand	892-894	3	1
α-helix	899-914	16
α-helix	922-924	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 1	A	protein	200	Homo sapiens	Q12959 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3W9Y_1 Disks large homolog 1 (chains A)
GSSGSSGNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVT
SREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLY
PISIFIKPKSMENIMEMNKRLTEEQARKTFERAMKLEQEFTEHFTAIVQGDTLEDIYNQV
KQIIEEQSGSYIWVPAKEKL

Primary citation

Crystal structure of the guanylate kinase domain from discs large homolog 1 (DLG1/SAP97). Mori, S., Tezuka, Y., Arakawa, A. et al. Biochem Biophys Res Commun (2013) 435:334-338. DOI 10.1016/j.bbrc.2013.04.056 · PubMed

Other PDB entries of the same protein (UniProt Q12959 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
2X7Z 2.0 Å, Crystal Structure of the SAP97 PDZ2 I342W C378A mutant protein domain
4G69 2.0 Å, Structure of the Human Discs Large 1 PDZ2 - Adenomatous Polyposis Coli Cytoskeletal…
8CN1 2.09 Å, hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1
3RL8 2.2 Å, Crystal structure of hDLG1-PDZ2 complexed with APC
3RL7 2.3 Å, Crystal structure of hDLG1-PDZ1 complexed with APC
4AMH 2.3 Å, Influence of circular permutation on the folding pathway of a PDZ domain
8CN3 2.71 Å, hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1
1PDR 2.8 Å, Crystal structure of the third PDZ domain from the human homolog of discs large protein
3LRA 2.95 Å, Structural Basis for Assembling a Human Tripartite Complex Dlg1-MPP7-Mals3
2M3M Solution structure of a complex consisting of hDlg/SAP-97 residues 318-406 and HPV51…
2OQS Structure of the hDLG/SAP97 PDZ2 in complex with HPV-18 papillomavirus E6 peptide

Browse structure collections

About this viewer

MolViewer shows 3W9Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.