8CN3: HDLG1-PDZ2

hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1. Determined by X-ray diffraction at 2.71 Å resolution. Released 2 Aug 2023.

Method: X-ray diffraction
Resolution: 2.71 Å
Organisms: Homo sapiens, Human T-cell lymphotrophic virus type 1 (strain ATK)
Chains: 4
Atoms: 1,368
Mol. weight: 25.72 kDa
Released: 2 Aug 2023

Explore 8CN3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CN3 contains 5 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
β-strand	20	1	2
β-strand	23	1	2
β-strand	26-30	5	1
β-strand	32	1	3
β-strand	37	1	4
β-strand	40	1	4
β-strand	43-48	6	1
α-helix	49	1
α-helix	53-57	5
β-strand	65-69	5	1
β-strand	72-73	2	1
β-strand	78	1	3
α-helix	79-87	9
β-strand	92-98	7	1

Chain B: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	12-18	7	5
β-strand	20	1	6
β-strand	23	1	6
β-strand	26-29	4	5
β-strand	37	1	7
β-strand	40	1	7
β-strand	43-48	6	5
α-helix	53-57	5
β-strand	65-69	5	5
β-strand	72	1	5
α-helix	79-87	9
β-strand	92-98	7	5

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	209-210	2	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	210	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 1	A	protein	117	Homo sapiens	Q12959 (AlphaFold model)
Disks large homolog 1	B	protein	117	Homo sapiens	Q12959 (AlphaFold model)
Glu-thr-glu-val	C, D	protein	4	Human T-cell lymphotrophic virus type 1 (strain ATK)	P03409

Sequence of entity 1 (A), FASTA

>8CN3_1 Disks large homolog 1 (chains A)
GPLGSKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKL
QIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNS

Sequence of entity 2 (B), FASTA

>8CN3_2 Disks large homolog 1 (chains B)
GPLGSKPVSEMIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKL
QIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNS

Sequence of entity 3 (C, D), FASTA

>8CN3_3 GLU-THR-GLU-VAL (chains C, D)
ETEV

Primary citation

Identification of small molecule antivirals against HTLV-1 by targeting the hDLG1-Tax-1 protein-protein interaction. Maseko, S.B., Brammerloo, Y., Van Molle, I. et al. Antiviral Res (2023) 217:105675-105675. DOI 10.1016/j.antiviral.2023.105675 · PubMed

Other PDB entries of the same protein (UniProt Q12959 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
2X7Z 2.0 Å, Crystal Structure of the SAP97 PDZ2 I342W C378A mutant protein domain
4G69 2.0 Å, Structure of the Human Discs Large 1 PDZ2 - Adenomatous Polyposis Coli Cytoskeletal…
8CN1 2.09 Å, hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1
3RL8 2.2 Å, Crystal structure of hDLG1-PDZ2 complexed with APC
3W9Y 2.2 Å, Crystal structure of the human DLG1 guanylate kinase domain
3RL7 2.3 Å, Crystal structure of hDLG1-PDZ1 complexed with APC
4AMH 2.3 Å, Influence of circular permutation on the folding pathway of a PDZ domain
1PDR 2.8 Å, Crystal structure of the third PDZ domain from the human homolog of discs large protein
3LRA 2.95 Å, Structural Basis for Assembling a Human Tripartite Complex Dlg1-MPP7-Mals3
2M3M Solution structure of a complex consisting of hDlg/SAP-97 residues 318-406 and HPV51…
2OQS Structure of the hDLG/SAP97 PDZ2 in complex with HPV-18 papillomavirus E6 peptide

Browse structure collections

About this viewer

MolViewer shows 8CN3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.