3RL8: HDLG1-PDZ2

Crystal structure of hDLG1-PDZ2 complexed with APC. Determined by X-ray diffraction at 2.2 Å resolution. Released 14 Dec 2011.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,811
Mol. weight: 58.51 kDa
Released: 14 Dec 2011

Explore 3RL8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3RL8 contains 15 α-helices and 55 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	317-323	7	1
β-strand	325	1	2
β-strand	328	1	2
β-strand	331-335	5	1
β-strand	337	1	3
β-strand	342	1	4
β-strand	345	1	4
β-strand	348-353	6	1
α-helix	358-362	5
α-helix	369	1
β-strand	370-374	5	1
β-strand	377-378	2	1
β-strand	383	1	3
α-helix	384-392	9
β-strand	397-403	7	1
α-helix	404-405	2

Chain B: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	317-323	7	5
β-strand	325	1	6
β-strand	328	1	6
β-strand	331-335	5	5
β-strand	337	1	7
β-strand	342	1	8
β-strand	345	1	8
β-strand	348-353	6	5
α-helix	358-362	5
α-helix	369	1
β-strand	370-374	5	5
β-strand	377-378	2	5
β-strand	383	1	7
α-helix	384-392	9
β-strand	397-403	7	5

Chains C and D: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	317-323	7	9
β-strand	325	1	10
β-strand	328	1	10
β-strand	331-335	5	9
β-strand	342	1	11
β-strand	345	1	11
β-strand	348-353	6	9
α-helix	358-362	5
α-helix	369	1
β-strand	370-374	5	9
β-strand	377-378	2	9
α-helix	384-392	9
β-strand	397-403	7	9

Chain E: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	317-323	7	15
β-strand	325	1	16
β-strand	328	1	16
β-strand	331-335	5	15
β-strand	342	1	17
β-strand	345	1	17
β-strand	348-353	6	15
α-helix	358-362	5
β-strand	370-374	5	15
β-strand	377-378	2	15
α-helix	384-392	9
β-strand	397-403	7	15

Chain F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2842	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 1	A, B, C, D, E	protein	105	Homo sapiens	Q12959 (AlphaFold model)
11-mer peptide from Adenomatous polyposis coli protein	F	protein	11	Homo sapiens	P25054

Sequence of entity 1 (A, B, C, D, E), FASTA

>3RL8_1 Disks large homolog 1 (chains A, B, C, D, E)
MGHHHHHHMEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKL
QIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYM

Sequence of entity 2 (F), FASTA

>3RL8_2 11-mer peptide from Adenomatous polyposis coli protein (chains F)
RHSGSYLVTSV

Primary citation

Molecular basis for the recognition of adenomatous polyposis coli by the Discs Large 1 protein. Zhang, Z., Li, H., Chen, L. et al. PLoS One (2011) 6:e23507-e23507. DOI 10.1371/journal.pone.0023507 · PubMed

Other PDB entries of the same protein (UniProt Q12959 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
2X7Z 2.0 Å, Crystal Structure of the SAP97 PDZ2 I342W C378A mutant protein domain
4G69 2.0 Å, Structure of the Human Discs Large 1 PDZ2 - Adenomatous Polyposis Coli Cytoskeletal…
8CN1 2.09 Å, hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1
3W9Y 2.2 Å, Crystal structure of the human DLG1 guanylate kinase domain
3RL7 2.3 Å, Crystal structure of hDLG1-PDZ1 complexed with APC
4AMH 2.3 Å, Influence of circular permutation on the folding pathway of a PDZ domain
8CN3 2.71 Å, hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1
1PDR 2.8 Å, Crystal structure of the third PDZ domain from the human homolog of discs large protein
3LRA 2.95 Å, Structural Basis for Assembling a Human Tripartite Complex Dlg1-MPP7-Mals3
2M3M Solution structure of a complex consisting of hDlg/SAP-97 residues 318-406 and HPV51…
2OQS Structure of the hDLG/SAP97 PDZ2 in complex with HPV-18 papillomavirus E6 peptide

Browse structure collections

About this viewer

MolViewer shows 3RL8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.