1S5G: Myosin heavy chain, striated muscle

Structure of Scallop myosin S1 reveals a novel nucleotide conformation. Determined by X-ray diffraction at 3.1 Å resolution. Released 22 Jun 2004.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Argopecten irradians
Chains: 3
Atoms: 8,607
Mol. weight: 131.6 kDa
Ligands: CA, MG, ADP
Released: 22 Jun 2004

Explore 1S5G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1S5G contains 51 α-helices and 40 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	8-12	5
β-strand	33-38	6	1
β-strand	42-51	10	1
β-strand	55-59	5	1
β-strand	67-70	4	1
α-helix	71-73	3
β-strand	75-76	2	1
α-helix	80-82	3
β-strand	87	1	2
α-helix	96-108	13
β-strand	113-116	4	2
β-strand	119-123	5	2
α-helix	134-140	7
α-helix	152-166	15
β-strand	170-175	6	3
α-helix	182-194	13
α-helix	215-230	16
β-strand	231-232	2	4
β-strand	240-241	2	4
β-strand	244-251	8	3
β-strand	257-261	5	3
β-strand	264-265	2	3
α-helix	269-272	4
α-helix	283-288	6
α-helix	294-300	7
α-helix	306-308	3
β-strand	319	1	5
β-strand	322	1	5
α-helix	326-338	13
α-helix	342-357	16
α-helix	358-360	3
β-strand	363-364	2	6
β-strand	373-374	2	6
α-helix	378-387	10
α-helix	391-399	9
β-strand	402	1	7
β-strand	405	1	8
β-strand	408	1	8
β-strand	411	1	7
α-helix	416-446	31
β-strand	454-460	7	3
β-strand	470	1	9
α-helix	472-502	31
α-helix	515-524	10
α-helix	529-535	7
α-helix	544-555	12
β-strand	562-563	2	9
α-helix	564-567	4
β-strand	578-582	5	9
β-strand	585-589	5	9
α-helix	594-598	5
α-helix	604-611	8
α-helix	616-621	6
α-helix	645-660	16
β-strand	664	1	3
β-strand	667-669	3	3
β-strand	670-671	2	2
α-helix	684-694	11
α-helix	696-704	9
β-strand	710-711	2	10
α-helix	713-720	8
α-helix	725-727	3
α-helix	735-745	11
β-strand	753-755	3	10
β-strand	760-762	3	10
α-helix	766-822	57
α-helix	825-832	8

Chain Y: 9 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	15-17	3
α-helix	22-24	3
α-helix	39-45	7
α-helix	54-57	4
α-helix	86-92	7
α-helix	93-96	4
β-strand	104-105	2	11
α-helix	106-115	10
α-helix	122-128	7
β-strand	134-135	2	11
β-strand	138-139	2	11
α-helix	141-149	9

Chain Z: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	9-20	12
β-strand	29	1	12
α-helix	30-38	9
α-helix	46-50	5
β-strand	62	1	12
α-helix	65-76	12
α-helix	83-91	9
β-strand	100-102	3	13
α-helix	103-112	10
α-helix	119-129	11
β-strand	138-140	3	13
α-helix	141-150	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin heavy chain, striated muscle	A	protein	840	Argopecten irradians	P24733 (AlphaFold model)
Myosin regulatory light chain, striated adductor muscle	Y	protein	156	Argopecten irradians	P13543 (AlphaFold model)
Myosin essential light chain, striated adductor muscle	Z	protein	156	Argopecten irradians	P07291 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1S5G_1 Myosin heavy chain, striated muscle (chains A)
MNIDFSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKI
VADSSTRTVKKDDIQSMNPPKFEKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFC
IAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMVTDRENQSCLITGESGA
GKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNS
SRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVM
LVTPDSGLYSFINQGCLTVDNIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGE
MKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVKVGTEMVTKGQNMNQVV
NSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYT
NERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFP
KADDKSFQDKLYQNHMGKNRMFTKPGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKD
PINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSSAFQTISAVHRESLNKLMKNL
YSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRY
SILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSK
IISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSKVKPLLSIA

Sequence of entity 2 (Y), FASTA

>1S5G_2 Myosin regulatory light chain, striated adductor muscle (chains Y)
ADKAASGVLTKLPQKQIQEMKEAFSMIDVDRDGFVSKEDIKAISEQLGRAPDDKELTAML
KEAPGPLNFTMFLSIFSDKLSGTDSEETIRNAFAMFDEQETKKLNIEYIKDLLENMGDNF
NKDEMRMTFKEAPVEGGKFDYVKFTAMIKGSGEEEA

Sequence of entity 3 (Z), FASTA

>1S5G_3 Myosin essential light chain, striated adductor muscle (chains Z)
PKLSQDEIDDLKDVFELFDFWDGRDGAVDAFKLGDVCRCLGINPRNEDVFAVGGTHKMGE
KSLPFEEFLPAYEGLMDCEQGTFADYMEAFKTFDREGQGFISGAELRHVLTALGERLSDE
DVDEIIKLTDLQEDLEGNVKYEDFVKKVMAGPYPDK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
MG	Magnesium ion	Mg	1
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Myosin subfragment 1 structures reveal a partially bound nucleotide and a complex salt bridge that helps couple nucleotide and actin binding. Risal, D., Gourinath, S., Himmel, D.M. et al. Proc Natl Acad Sci U S A (2004) 101:8930-8935. DOI 10.1073/pnas.0403002101 · PubMed

Other PDB entries of the same protein (UniProt P24733 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WDC 2.0 Å, Scallop myosin regulatory domain
3JVT 2.1 Å, Calcium-bound Scallop Myosin Regulatory Domain (Lever Arm) with Reconstituted Complete…
1KK8 2.3 Å, Scallop myosin (S1-ADP-befx) in the actin-detached conformation
3BAS 2.3 Å, Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (C2) form
3BAT 2.3 Å, Crystal structure of the N-terminal region of the scallop myosin rod, monoclinic (P21)…
1B7T 2.5 Å, Myosin digested by papain
1QVI 2.54 Å, Crystal structure of scallop myosin S1 in the pre-power stroke state to 2.6 Angstrom…
3JTD 2.57 Å, Calcium-free Scallop Myosin Regulatory Domain with ELC-D19A Point Mutation
1SR6 2.75 Å, Structure of nucleotide-free scallop myosin S1
1L2O 2.8 Å, Scallop myosin S1-ADP-p-pdm in the actin-detached conformation
1SCM 2.8 Å, Structure of the regulatory domain of scallop myosin at 2.8 Å resolution
1KQM 3.0 Å, Scallop myosin S1-amppnp in the actin-detached conformation

Browse structure collections

About this viewer

MolViewer shows 1S5G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.