1SB0: KIX domain of CBP

Solution structure of the KIX domain of CBP bound to the transactivation domain of c-Myb. Determined by solution NMR. Released 13 Apr 2004.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 934
Mol. weight: 13.3 kDa
Released: 13 Apr 2004

Explore 1SB0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SB0 contains 6 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-9	3
α-helix	12-26	15
α-helix	32-36	5
α-helix	38-57	20
α-helix	61-79	19

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	89-108	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
protein CBP	A	protein	87	Mus musculus	P45481 (AlphaFold model)
protein c-Myb	B	protein	25	Mus musculus	P06876 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SB0_1 protein CBP (chains A)
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANS
RDEYYHLLAEKIYKIQKELEEKRRSRL

Sequence of entity 2 (B), FASTA

>1SB0_2 protein c-Myb (chains B)
KEKRIKELELLLMSTENELKGQQAL

Primary citation

Solution Structure of the KIX Domain of CBP Bound to the Transactivation Domain of c-Myb. Zor, T., De Guzman, R.N., Dyson, H.J. et al. J Mol Biol (2004) 337:521-534. DOI 10.1016/j.jmb.2004.01.038 · PubMed

Other PDB entries of the same protein (UniProt P45481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5W0I 1.43 Å, CREBBP Bromodomain in complex with Cpd8 (1-(3-(7-(difluoromethyl)-6-(1-methyl-1H-pyrazol-…
8CNB 1.99 Å, Crystal structure of CREBBP-Y1503C histone acetyltransferase domain in complex with…
4I9O 2.0 Å, Crystal Structure of GACKIX L664C Tethered to 1-10
7LVS 2.02 Å, The CBP TAZ1 Domain in Complex with a CITED2-HIF-1-Alpha Fusion Peptide
8CMZ 2.25 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with…
6DNQ 2.35 Å, HBZ77 in complex with KIX and c-Myb
5U7G 2.4 Å, Crystal Structure of the Catalytic Core of CBP
8CN0 2.44 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with…
8CNA 2.46 Å, Crystal structure of CREBBP-R1446C histone acetyltransferase domain in complex with a…
8OG2 2.47 Å, Crystal structure of CREBBP histone acetyltransferase domain in complex with Coenzyme A
6DMX 2.8 Å, HBZ56 in complex with KIX and c-Myb
8CND 2.97 Å, Crystal structure of CREBBP-Y1482N histone acetyltransferase domain in complex with a…

Browse structure collections

About this viewer

MolViewer shows 1SB0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.