1SN6: Human Saposin C in SDS micelles

NMR solution structure of human Saposin C in SDS micelles. Determined by solution NMR. Released 1 Mar 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 653
Mol. weight: 9.42 kDa
Released: 1 Mar 2005

Explore 1SN6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SN6 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-19	17
α-helix	26-38	13
α-helix	42-53	12
α-helix	56-60	5
α-helix	61-65	5
α-helix	68-75	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proactivator polypeptide	A	protein	84	Homo sapiens	P07602 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1SN6_1 Proactivator polypeptide (chains A)
SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILS
ILLEEVSPELVCSMLHLCSGLVPR

Primary citation

Solution structure of human saposin C in a detergent environment. Hawkins, C.A., Alba, E., Tjandra, N. J Mol Biol (2005) 346:1381-1392. DOI 10.1016/j.jmb.2004.12.045 · PubMed

Other PDB entries of the same protein (UniProt P07602 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BQP 1.3 Å, Crystal Structure of Human Saposin D (orthorhombic)
9I63 1.65 Å, Synthetic Human Saposin D glycoprotein
4UEX 1.8 Å, Structure of human Saposin A at lysosomal pH
4DDJ 1.9 Å, Crystal structure of saposin A in complex with lauryldimethylamine-N-oxide (LDAO)
2DOB 2.0 Å, Crystal Structure of Human Saposin A
3BQQ 2.0 Å, Crystal Structure of Human Saposin D (triclinic)
2RB3 2.1 Å, Crystal Structure of Human Saposin D
4V2O 2.13 Å, Structure of saposin B in complex with chloroquine
1N69 2.2 Å, Crystal structure of human saposin B
6SLR 2.38 Å, Structure of saposin B in complex with atovaquone
2GTG 2.4 Å, Crystal Structure of Human Saposin C
2QYP 2.45 Å, Orthorhombic Crystal Structure of Human Saposin C Dimer in Open Conformation

Browse structure collections

About this viewer

MolViewer shows 1SN6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.