1T2K: DNA Binding Domains Of IRF3, ATF-2 and Jun

Structure Of The DNA Binding Domains Of IRF3, ATF-2 and Jun Bound To DNA. Determined by X-ray diffraction at 3.0 Å resolution. Released 16 Nov 2004.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 6
Atoms: 4,034
Mol. weight: 59.63 kDa
Released: 16 Nov 2004

Explore 1T2K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1T2K contains 10 α-helices and 10 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	8-18	11
β-strand	25-26	2	1
β-strand	33-37	5	1
α-helix	48-51	4
α-helix	52-61	10
β-strand	66	1	2
β-strand	69	1	2
α-helix	73-85	13
β-strand	90-95	6	1
β-strand	104-109	6	1

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	8-18	11
β-strand	25-26	2	3
β-strand	33-37	5	3
α-helix	52-60	9
α-helix	73-85	13
β-strand	90-95	6	3
β-strand	104-109	6	3

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	255-313	59

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	337-394	58

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
31-MER	E	DNA	31
31-MER	F	DNA	31
Interferon regulatory factor 3	A, B	protein	112	Homo sapiens	Q14653 (AlphaFold model)
Transcription factor AP-1	C	protein	62	Homo sapiens	P05412 (AlphaFold model)
Cyclic-AMP-dependent transcription factor ATF-2	D	protein	61	Homo sapiens	P15336 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>1T2K_1 31-MER (chains E)
TAAATGACATAGGAAAACTGAAAGGGAGAAG

Sequence of entity 2 (F), FASTA

>1T2K_2 31-MER (chains F)
ACTTCTCCCTTTCAGTTTTCCTATGTCATTT

Sequence of entity 3 (A, B), FASTA

>1T2K_3 Interferon regulatory factor 3 (chains A, B)
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNS

Sequence of entity 4 (C), FASTA

>1T2K_4 Transcription factor AP-1 (chains C)
MKAERKRMRNRIAASKSRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKV
MN

Sequence of entity 5 (D), FASTA

>1T2K_5 Cyclic-AMP-dependent transcription factor ATF-2 (chains D)
KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLL
A

Primary citation

Crystal structure of ATF-2/c-Jun and IRF-3 bound to the interferon-beta enhancer. Panne, D., Maniatis, T., Harrison, S.C. EMBO J (2004) 23:4384-4393. DOI 10.1038/sj.emboj.7600453 · PubMed

Other PDB entries of the same protein (UniProt Q14653 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SJA 1.5 Å, Structure of HPV16 E6 oncoprotein in complex with IRF3 LxxLL motif
5JEL 1.6 Å, Phosphorylated TRIF in complex with IRF-3
7JFL 1.68 Å, Crystal structure of human phosphorylated IRF-3 bound to CBP
5JEO 1.72 Å, Phosphorylated Rotavirus NSP1 in complex with IRF-3
6SIV 1.75 Å, Structure of HPV16 E6 oncoprotein in complex with mutant IRF3 LxxLL motif
3A77 1.8 Å, The crystal structure of phosphorylated IRF-3
5JEJ 2.0 Å, Phosphorylated STING in complex with IRF-3 CTD
1QWT 2.1 Å, Auto-inhibitory interferon regulation factor-3 (IRF3) transactivation domain
1J2F 2.3 Å, X-ray crystal structure of IRF-3 and its functional implications
3QU6 2.3 Å, Crystal structure of IRF-3 DBD free form
2PI0 2.31 Å, Crystal Structure of IRF-3 bound to the PRDIII-I regulatory element of the human…
1ZOQ 2.37 Å, IRF3-CBP complex

Browse structure collections

About this viewer

MolViewer shows 1T2K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.