1TXQ: EB1 C-terminal domain

Crystal structure of the EB1 C-terminal domain complexed with the CAP-Gly domain of p150Glued. Determined by X-ray diffraction at 1.8 Å resolution. Released 13 Sept 2005.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,175
Mol. weight: 19.71 kDa
Released: 13 Sept 2005

Explore 1TXQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1TXQ contains 3 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	32-35	4	1
β-strand	41-48	8	1
β-strand	57-62	6	1
β-strand	69	1	1
β-strand	72-73	2	2
β-strand	76-77	2	2
β-strand	86-89	4	1
α-helix	91-93	3
β-strand	94-96	3	1

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	193-230	38
α-helix	237-246	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dynactin 1	A	protein	93	Homo sapiens	Q14203 (AlphaFold model)
Microtubule-associated protein RP/EB family member 1	B	protein	86	Homo sapiens	Q15691 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1TXQ_1 Dynactin 1 (chains A)
GSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQ
GRKYFTCDEGHGIFVRQSQIQVFEDGADTTSPE

Sequence of entity 2 (B), FASTA

>1TXQ_2 Microtubule-associated protein RP/EB family member 1 (chains B)
NPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRI
VDILYATDEGFVIPDEGGPQEEQEEY

Primary citation

Structural Basis for the Activation of Microtubule Assembly by the EB1 and p150(Glued) Complex. Hayashi, I., Wilde, A., Mal, T.K. et al. Mol Cell (2005) 19:449-460. DOI 10.1016/j.molcel.2005.06.034 · PubMed

Other PDB entries of the same protein (UniProt Q14203 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HQH 1.8 Å, Crystal structure of p150Glued and CLIP-170
2HKQ 1.86 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the CAP-Gly…
2HKN 1.87 Å, Crystal structure of the CAP-Gly domain of human Dynactin-1 (p150-Glued)
2HL5 1.93 Å, Crystal structure of the C-terminal domain of human EB1 in complex with the A49M mutant…
2HL3 2.03 Å, Crystal structure of the A49M mutant CAP-Gly domain of human Dynactin-1 (p150-Glued) in…
3TQ7 2.3 Å, EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued
3E2U 2.6 Å, Crystal structure of the zink-knuckle 2 domain of human CLIP-170 in complex with CAP-Gly…
9B7J 3.49 Å, Cryo-EM structure of human dynactin complex bound to Chlamydia effector Dre1
9YND 4.26 Å, Motor domain of human dynein-1 in pre-power stroke bound to dynactin-p150glued-CC1B and…
9YNH 5.5 Å, Full-length human cytoplasmic dynein-1 in phi-like state bound to dynactin-p150glued and…
9YNE 8.46 Å, Motor domain of human dynein-1 in pre-power stroke bound to dynactin-p150glued-CC1B-ICD…
2COY Solution structure of the CAP-Gly domain in human Dynactin 1

Browse structure collections

About this viewer

MolViewer shows 1TXQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.