human RANTES complexed to heparin-derived disaccharide III-S. Determined by X-ray diffraction at 2.0 Å resolution. Released 9 Nov 2004.
Explore 1U4M in 3D Show helices and sheets RCSB PDB PDBe
1U4M contains 8 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6 | 1 | 1 |
| β-strand | 8-10 | 3 | 2 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 3 |
| α-helix | 30-31 | 2 | |
| β-strand | 39-43 | 5 | 3 |
| β-strand | 48-51 | 4 | 3 |
| α-helix | 56-65 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-10 | 3 | 2 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 1 |
| α-helix | 30-31 | 2 | |
| β-strand | 39-43 | 5 | 1 |
| β-strand | 48-51 | 4 | 1 |
| α-helix | 56-67 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Small inducible cytokine A5 | A, B | protein | 68 | Homo sapiens | P13501 (AlphaFold model) |
>1U4M_1 Small inducible cytokine A5 (chains A, B) SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVRE YINSLEMS
The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors. Shaw, J.P., Johnson, Z., Borlat, F. et al. Structure (2004) 12:2081-2093. DOI 10.1016/j.str.2004.08.014 · PubMed
Other PDB entries of the same protein (UniProt P13501 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1U4M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.