1UPL: MO25 alpha

Crystal structure of MO25 alpha. Determined by X-ray diffraction at 2.6 Å resolution. Released 22 Jan 2004.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 5,119
Mol. weight: 80.69 kDa
Released: 22 Jan 2004

Explore 1UPL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1UPL contains 48 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	14-26	13
α-helix	36-54	19
β-strand	65	1	1
α-helix	66-68	3
α-helix	69-77	9
α-helix	79-85	7
α-helix	87-89	3
α-helix	92-107	16
β-strand	110	1	2
β-strand	113	1	2
α-helix	115-121	7
α-helix	125-132	8
α-helix	133-135	3
α-helix	140-150	11
α-helix	154-161	8
α-helix	164-168	5
α-helix	169-172	4
α-helix	178-193	16
α-helix	196-205	10
α-helix	207-218	12
α-helix	223-238	16
α-helix	240-242	3
α-helix	243-249	7
α-helix	253-262	10
α-helix	268-283	16
α-helix	289-297	9
α-helix	299-306	8
α-helix	317-331	15

Chain B: 23 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	12-26	15
α-helix	41-54	14
α-helix	64-77	14
α-helix	79-85	7
α-helix	87-89	3
α-helix	92-106	15
β-strand	110	1	3
β-strand	113	1	3
α-helix	115-121	7
α-helix	125-132	8
α-helix	133-135	3
α-helix	140-151	12
α-helix	154-161	8
α-helix	164-168	5
α-helix	169-172	4
α-helix	178-193	16
α-helix	196-217	22
α-helix	223-238	16
α-helix	240-242	3
α-helix	243-249	7
α-helix	253-262	10
α-helix	268-283	16
β-strand	288	1	1
α-helix	289-297	9
α-helix	299-307	9
α-helix	319-331	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MO25 protein	A, B	protein	341	HOMO SAPIENS	Q9Y376 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1UPL_1 MO25 PROTEIN (chains A, B)
MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEK
EPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYI
CTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDI
ASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQA
KLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA

Primary citation

Crystal Structure of Mo25 Alpha in Complex with the C-Terminus of the Pseudo Kinase Ste-20 Related Adaptor (Strad). Milburn, C.C., Boudeau, J., Deak, M. et al. Nat Struct Mol Biol (2004) 11:193. DOI 10.1038/NSMB716 · PubMed

Other PDB entries of the same protein (UniProt Q9Y376 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UPK 1.85 Å, Crystal structure of MO25 in complex with a C-terminal peptide of STRAD
3GNI 2.35 Å, Structure of STRAD and MO25
2WTK 2.65 Å, Structure of the heterotrimeric LKB1-STRADalpha-MO25alpha complex
8VSU 2.86 Å, Cryo-EM structure of LKB1-STRADalpha-MO25alpha heterocomplex
4FZA 3.15 Å, Crystal structure of MST4-MO25 complex
4O27 3.19 Å, Crystal structure of MST3-MO25 complex with WIF motif
4FZD 3.25 Å, Crystal structure of MST4-MO25 complex with WSF motif
4NZW 3.58 Å, Crystal Structure of STK25-MO25 Complex
4FZF 3.64 Å, Crystal structure of MST4-MO25 complex with DKI

Browse structure collections

About this viewer

MolViewer shows 1UPL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.