4O27: MST3-MO25 complex with WIF motif

Crystal structure of MST3-MO25 complex with WIF motif. Determined by X-ray diffraction at 3.19 Å resolution. Released 3 Dec 2014.

Method: X-ray diffraction
Resolution: 3.19 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,841
Mol. weight: 71.21 kDa
Ligands: ADP, MN
Released: 3 Dec 2014

Explore 4O27 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4O27 contains 39 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	14-25	12
α-helix	35-54	20
α-helix	67-77	11
α-helix	79-85	7
α-helix	87-89	3
α-helix	92-107	16
β-strand	110	1	1
β-strand	113	1	1
α-helix	115-122	8
α-helix	125-132	8
α-helix	133-135	3
α-helix	137-152	16
α-helix	154-162	9
α-helix	164-168	5
α-helix	169-172	4
α-helix	178-194	17
α-helix	196-217	22
α-helix	223-238	16
α-helix	243-249	7
α-helix	253-263	11
α-helix	268-283	16
α-helix	289-297	9
α-helix	301-307	7
α-helix	317-330	14

Chain B: 17 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	20-23	4
β-strand	24-32	9	2
β-strand	37-43	7	2
β-strand	48-56	9	2
α-helix	57-60	4
α-helix	65-76	12
β-strand	82	1	3
β-strand	85-91	7	2
β-strand	94-100	7	2
β-strand	105-106	2	3
α-helix	107-110	4
α-helix	118-137	20
β-strand	140-141	2	4
α-helix	147-149	3
β-strand	150-152	3	3
β-strand	158-160	3	3
α-helix	166	1
β-strand	167-168	2	4
β-strand	176	1	5
α-helix	183-185	3
α-helix	188-191	4
β-strand	196	1	5
α-helix	199-214	16
α-helix	224-233	10
α-helix	235-237	3
α-helix	245-254	10
α-helix	259-261	3
α-helix	263-264	2
α-helix	265-268	4
α-helix	285-296	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium-binding protein 39	A	protein	325	Homo sapiens	Q9Y376 (AlphaFold model)
Serine/threonine-protein kinase 24	B	protein	281	Homo sapiens	Q9Y6E0 (AlphaFold model)
5-mer peptide from serine/threonine-protein kinase 24	C	protein	5		Q9Y6E0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4O27_1 Calcium-binding protein 39 (chains A)
MASPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVA
QLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILF
MLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATF
KDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTK
YISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQAKLIEFLSK
FQNDRTEDEQFNDEKTYLVKQIRDL

Sequence of entity 2 (B), FASTA

>4O27_2 Serine/threonine-protein kinase 24 (chains B)
MADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQ
CDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLH
SEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNEFVGTPFWMAPEVIKQSAY
DSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLN
KEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAE

Sequence of entity 3 (C), FASTA

>4O27_3 5-mer peptide from serine/threonine-protein kinase 24 (chains C)
DWIFE

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1
MN	Manganese (II) ion	Mn	1

Primary citation

Structural insights into regulatory mechanisms of MO25-mediated kinase activation. Hao, Q., Feng, M., Shi, Z. et al. J Struct Biol (2014) 186:224-233. DOI 10.1016/j.jsb.2014.04.005 · PubMed

Other PDB entries of the same protein (UniProt Q9Y376 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UPK 1.85 Å, Crystal structure of MO25 in complex with a C-terminal peptide of STRAD
3GNI 2.35 Å, Structure of STRAD and MO25
1UPL 2.6 Å, Crystal structure of MO25 alpha
2WTK 2.65 Å, Structure of the heterotrimeric LKB1-STRADalpha-MO25alpha complex
8VSU 2.86 Å, Cryo-EM structure of LKB1-STRADalpha-MO25alpha heterocomplex
4FZA 3.15 Å, Crystal structure of MST4-MO25 complex
4FZD 3.25 Å, Crystal structure of MST4-MO25 complex with WSF motif
4NZW 3.58 Å, Crystal Structure of STK25-MO25 Complex
4FZF 3.64 Å, Crystal structure of MST4-MO25 complex with DKI

Browse structure collections

About this viewer

MolViewer shows 4O27 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.