3GNI: STRAD and MO25

Structure of STRAD and MO25. Determined by X-ray diffraction at 2.35 Å resolution. Released 16 Jun 2009.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,323
Mol. weight: 84.38 kDa
Ligands: CIT, ATP
Released: 16 Jun 2009

Explore 3GNI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3GNI contains 46 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
α-helix	12-27	16
α-helix	33-55	23
α-helix	61-63	3
α-helix	64-77	14
α-helix	79-85	7
α-helix	87-89	3
α-helix	92-106	15
β-strand	110	1	1
β-strand	113	1	1
α-helix	115-122	8
α-helix	125-132	8
α-helix	133-135	3
α-helix	140-150	11
α-helix	154-161	8
α-helix	165-168	4
α-helix	169-172	4
α-helix	178-193	16
α-helix	196-205	10
α-helix	207-217	11
α-helix	223-237	15
α-helix	240-242	3
α-helix	243-249	7
α-helix	253-262	10
α-helix	268-283	16
α-helix	289-297	9
α-helix	299-307	9
α-helix	317-331	15

Chain B: 20 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	-9--6	4
α-helix	61-63	3
α-helix	66-68	3
β-strand	69-78	10	2
β-strand	83-90	8	2
β-strand	96-103	8	2
α-helix	104-106	3
α-helix	109-124	16
β-strand	130	1	3
α-helix	131-132	2
β-strand	133-139	7	2
β-strand	142-148	7	2
β-strand	154	1	3
α-helix	155-161	7
α-helix	169-188	20
β-strand	191-192	2	4
α-helix	198-200	3
β-strand	201-203	3	3
β-strand	209-211	3	3
α-helix	214-216	3
β-strand	218-219	2	4
β-strand	221-222	2	5
β-strand	225-226	2	5
β-strand	230	1	6
α-helix	241-243	3
α-helix	246-249	4
β-strand	256	1	6
α-helix	259-274	16
α-helix	287-290	4
α-helix	350-359	10
α-helix	368-369	2
α-helix	370-373	4
α-helix	377-381	5
α-helix	390-393	4
α-helix	426-429	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein Mo25	A	protein	341	Homo sapiens	Q9Y376 (AlphaFold model)
STRAD alpha	B	protein	389	Homo sapiens	Q7RTN6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3GNI_1 Protein Mo25 (chains A)
MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEK
EPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYI
CTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDI
ASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQA
KLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA

Sequence of entity 2 (B), FASTA

>3GNI_2 STRAD alpha (chains B)
MAHHHHHHMENLYFQGMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRI
NLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTH
FMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMIS
HGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDM
PATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSH
PYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITN
FEGSQSQDHSGIFGLVTNLEELEVDDWEF

Ligands and cofactors

ID	Name	Formula	Copies
CIT	Citric acid	C6 H8 O7	1
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Primary citation

ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor. Zeqiraj, E., Filippi, B.M., Goldie, S. et al. PLoS Biol (2009) 7:e1000126-e1000126. DOI 10.1371/journal.pbio.1000126 · PubMed

Other PDB entries of the same protein (UniProt Q9Y376 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UPK 1.85 Å, Crystal structure of MO25 in complex with a C-terminal peptide of STRAD
1UPL 2.6 Å, Crystal structure of MO25 alpha
2WTK 2.65 Å, Structure of the heterotrimeric LKB1-STRADalpha-MO25alpha complex
8VSU 2.86 Å, Cryo-EM structure of LKB1-STRADalpha-MO25alpha heterocomplex
4FZA 3.15 Å, Crystal structure of MST4-MO25 complex
4O27 3.19 Å, Crystal structure of MST3-MO25 complex with WIF motif
4FZD 3.25 Å, Crystal structure of MST4-MO25 complex with WSF motif
4NZW 3.58 Å, Crystal Structure of STK25-MO25 Complex
4FZF 3.64 Å, Crystal structure of MST4-MO25 complex with DKI

Browse structure collections

About this viewer

MolViewer shows 3GNI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.