8VSU: LKB1-STRADalpha-MO25alpha heterocomplex

Cryo-EM structure of LKB1-STRADalpha-MO25alpha heterocomplex. Determined by electron microscopy at 2.86 Å resolution. Released 10 Jul 2024.

Method: Electron microscopy
Resolution: 2.86 Å
Organism: Homo sapiens
Chains: 3
Atoms: 7,594
Mol. weight: 140.94 kDa
Ligands: ADP
Released: 10 Jul 2024

Explore 8VSU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8VSU contains 61 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	12-26	15
α-helix	33-55	23
β-strand	57	1	1
β-strand	60	1	1
α-helix	61-63	3
α-helix	64-76	13
α-helix	79-85	7
α-helix	87-89	3
α-helix	92-106	15
β-strand	110	1	2
β-strand	113	1	2
α-helix	115-120	6
α-helix	125-132	8
α-helix	133-135	3
α-helix	140-150	11
α-helix	154-161	8
α-helix	164-168	5
α-helix	169-172	4
α-helix	178-193	16
α-helix	196-205	10
α-helix	207-218	12
α-helix	223-238	16
α-helix	240-242	3
α-helix	243-249	7
α-helix	253-262	10
α-helix	268-283	16
α-helix	289-297	9
α-helix	299-306	8
α-helix	317-331	15

Chain B: 19 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	66-68	3
β-strand	69-78	10	7
β-strand	83-90	8	7
β-strand	95-103	9	7
α-helix	104-106	3
α-helix	109-124	16
β-strand	130	1	8
α-helix	131-132	2
β-strand	133-139	7	7
β-strand	142-148	7	7
β-strand	154	1	8
α-helix	155-159	5
α-helix	169-188	20
β-strand	191-192	2	9
α-helix	198-200	3
β-strand	201-203	3	8
β-strand	209-211	3	8
α-helix	214-216	3
β-strand	218-219	2	9
β-strand	221-222	2	10
β-strand	225-226	2	10
β-strand	230	1	11
α-helix	232-234	3
α-helix	238-243	6
α-helix	246-249	4
β-strand	256	1	11
α-helix	259-274	16
α-helix	284-292	9
α-helix	350-358	9
α-helix	364-366	3
α-helix	368-369	2
α-helix	370-373	4
α-helix	377-381	5
α-helix	386-393	8

Chain C: 17 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	45-46	2	3
β-strand	49-57	9	3
β-strand	62-68	7	3
β-strand	74-81	8	3
α-helix	82-85	4
α-helix	91-102	12
β-strand	110	1	4
β-strand	113-119	7	3
β-strand	124-130	7	3
β-strand	134-135	2	4
α-helix	136-140	5
α-helix	150-169	20
β-strand	172-173	2	5
α-helix	179-181	3
β-strand	182-184	3	4
β-strand	190-192	3	4
α-helix	195-197	3
β-strand	199-200	2	5
α-helix	201-202	2
β-strand	209-210	2	6
α-helix	217-219	3
α-helix	222-225	4
β-strand	231-232	2	6
α-helix	233-250	18
α-helix	260-268	9
α-helix	280-288	9
α-helix	298-299	2
α-helix	300-305	6
α-helix	307-310	4
α-helix	318-325	8
α-helix	338-344	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calcium-binding protein 39	A	protein	362	Homo sapiens	Q9Y376 (AlphaFold model)
Serine/threonine-protein kinase STK11	C	protein	449	Homo sapiens	Q15831 (AlphaFold model)
Isoform 3 of STE20-related kinase adapter protein alpha	B	protein	429	Homo sapiens	Q7RTN6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8VSU_1 Calcium-binding protein 39 (chains A)
MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEK
EPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYI
CTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDI
ASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDR
HNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKVFVANPNKTQPILDILLKNQA
KLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEAGSGATNFSLLKQAGDVEEN
PG

Sequence of entity 2 (C), FASTA

>8VSU_2 Serine/threonine-protein kinase STK11 (chains C)
PDYKDDDDKENLYFQGMEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAK
LIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRR
LRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGL
EYLHSQGIVHKDIKPGNLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEI
ANGLDTFSGFKVDIWSAGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSD
LLKGMLEYEPAKRFSIRQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDL
HGADEDEDLFDIEDDIIYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKS
RAEGRAPNPARKACSASSKIRRLSACKQQ

Sequence of entity 3 (B), FASTA

>8VSU_3 Isoform 3 of STE20-related kinase adapter protein alpha (chains B)
PHHHHHHENLYFQGMSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLM
TVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNEL
WVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILI
SVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIY
SVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGL
SDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIK
RRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTNLEELEVDDWEFGSGATNFSLLKQ
AGDVEENPG

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	1

Primary citation

High-resolution single-particle imaging at 100-200 keV with the Gatan Alpine direct electron detector. Chan, L.M., Courteau, B.J., Maker, A. et al. J Struct Biol (2024) 216:108108-108108. DOI 10.1016/j.jsb.2024.108108 · PubMed

Other PDB entries of the same protein (UniProt Q9Y376 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UPK 1.85 Å, Crystal structure of MO25 in complex with a C-terminal peptide of STRAD
3GNI 2.35 Å, Structure of STRAD and MO25
1UPL 2.6 Å, Crystal structure of MO25 alpha
2WTK 2.65 Å, Structure of the heterotrimeric LKB1-STRADalpha-MO25alpha complex
4FZA 3.15 Å, Crystal structure of MST4-MO25 complex
4O27 3.19 Å, Crystal structure of MST3-MO25 complex with WIF motif
4FZD 3.25 Å, Crystal structure of MST4-MO25 complex with WSF motif
4NZW 3.58 Å, Crystal Structure of STK25-MO25 Complex
4FZF 3.64 Å, Crystal structure of MST4-MO25 complex with DKI

Browse structure collections

About this viewer

MolViewer shows 8VSU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.