1X3Q: Chromo-2 Domain of cpSRP43

3D Solution Structure of the Chromo-2 Domain of cpSRP43. Determined by solution NMR. Released 20 Sept 2005.

Method: Solution NMR
Organism: Arabidopsis thaliana
Chains: 1
Atoms: 462
Mol. weight: 6.55 kDa
Released: 20 Sept 2005

Explore 1X3Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1X3Q contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	19	1	1
β-strand	22	1	1
α-helix	45-54	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cpSRP43	A	protein	57	Arabidopsis thaliana	O22265 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1X3Q_1 cpSRP43 (chains A)
GSQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEY

Primary citation

3D Solution Structure of the Chromo-2 domain of cpSRP43. Sivaraja, V., Kumar, T.K.S., Henry, R. et al. To be published.

Other PDB entries of the same protein (UniProt O22265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DEO 1.5 Å, Structural basis for specific substrate recognition by the chloroplast signal…
3DEP 2.7 Å, Structural basis for specific substrate recognition by the chloroplast signal…
5E4X 2.75 Å, Crystal structure of cpSRP43 chromodomain 3
5E4W 2.8 Å, Crystal structure of cpSRP43 chromodomains 2 and 3 in complex with the Alb3 tail
3UI2 3.18 Å, Crystal structure of the cpSRP54 tail bound to cpSRP43
1X32 Three Dimensional Solution Structure of the Chromo1 domain of cpSRP43
1X3P 3D solution structure of the Chromo-3 domain of cpSRP43
2HUG 3D Solution Structure of the Chromo-2 Domain of cpSRP43 complexed with cpSRP54 peptide
2N88 Chromodomain 3 (CD3) of cpSRP43

Browse structure collections

About this viewer

MolViewer shows 1X3Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.