Solution structure of the second PDZ domain of harmonin protein. Determined by solution NMR. Released 16 Nov 2005.
Explore 1X5N in 3D Show helices and sheets RCSB PDB PDBe
1X5N contains 2 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-21 | 5 | 1 |
| β-strand | 31-35 | 5 | 1 |
| β-strand | 43-48 | 6 | 1 |
| β-strand | 64-68 | 5 | 1 |
| β-strand | 71-72 | 2 | 1 |
| α-helix | 80-87 | 8 | |
| β-strand | 91-95 | 5 | 1 |
| α-helix | 102-105 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Harmonin | A | protein | 114 | Homo sapiens | Q9Y6N9 (AlphaFold model) |
>1X5N_1 Harmonin (chains A) GSSGSSGSPGNRENKEKKVFISLVGSRGLGCSISSGPIQKPGIFISHVKPGSLSAEVGLE IGDQIVEVNGVDFSNLDHKEAVNVLKSSRSLTISIVAAAGRELFMTDRSGPSSG
Solution structure of the second PDZ domain of harmonin protein. Qin, X.R., Hayashi, F., Yokoyama, S. To be published.
Other PDB entries of the same protein (UniProt Q9Y6N9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1X5N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.