2A1I: Central Domain of Human ERCC1

Crystal Structure of the Central Domain of Human ERCC1. Determined by X-ray diffraction at 1.9 Å resolution. Released 2 Aug 2005.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,170
Mol. weight: 16.88 kDa
Ligands: HG
Released: 2 Aug 2005

Explore 2A1I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A1I contains 8 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	100	1
β-strand	101-103	3	1
α-helix	105-107	3
α-helix	111-115	5
β-strand	121-123	3	1
β-strand	130-133	4	1
β-strand	136-142	7	1
α-helix	143-148	6
α-helix	152-160	9
β-strand	166-172	7	1
α-helix	179-192	14
β-strand	195-199	5	1
α-helix	202-213	12
α-helix	222-226	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA excision repair protein ERCC-1	A	protein	146	Homo sapiens	P07992 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2A1I_1 DNA excision repair protein ERCC-1 (chains A)
MGSSHHHHHHSQDPAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFL
SLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWS
PEEAGRYLETYKAYEQKPADLLMEKL

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	1

Primary citation

Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1. Tsodikov, O.V., Enzlin, J.H., Scharer, O.D. et al. Proc Natl Acad Sci U S A (2005) 102:11236-11241. DOI 10.1073/pnas.0504341102 · PubMed

Other PDB entries of the same protein (UniProt P07992 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A1J 2.7 Å, Crystal Structure of the Complex between the C-Terminal Domains of Human XPF and ERCC1
9QEC 2.9 Å, Cryo-EM structure of the XPF-ERCC1-XPA complex
9QED 3.2 Å, Cryo-EM structure of the XPF-ERCC1-SLX4(330-555)-SLX4IP complex
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
9QEE 3.4 Å, Cryo-EM structure of a DNA-bound XPF-ERCC1-SLX4(330-555)-SLX4IP complex
6SXA 3.6 Å, XPF-ERCC1 Cryo-EM Structure, Apo-form
9PCP 4.3 Å, NER dual incision complex - NoG
6SXB 7.9 Å, XPF-ERCC1 Cryo-EM Structure, DNA-Bound form
1Z00 Solution structure of the C-terminal domain of ERCC1 complexed with the C-terminal…
2JNW Solution structure of a ERCC1-XPA heterodimer
2JPD Solution structure of the ERCC1 central domain

Browse structure collections

About this viewer

MolViewer shows 2A1I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.