2JPD: ERCC1 central domain

Solution structure of the ERCC1 central domain. Determined by solution NMR. Released 4 Sept 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 996
Mol. weight: 15.46 kDa
Released: 4 Sept 2007

Explore 2JPD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JPD contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	101-103	3	1
α-helix	105-107	3
α-helix	111-115	5
β-strand	121-123	3	1
β-strand	130-133	4	1
β-strand	136-142	7	1
α-helix	143-148	6
α-helix	151-163	13
β-strand	166-172	7	1
α-helix	179-192	14
β-strand	195-199	5	1
α-helix	202-215	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA excision repair protein ERCC-1	A	protein	135	Homo sapiens	P07992 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JPD_1 DNA excision repair protein ERCC-1 (chains A)
MAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIH
GRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWSPEEAGRYLETYKA
YEQKPGGLEHHHHHH

Primary citation

Analysis of the XPA and ssDNA-binding surfaces on the central domain of human ERCC1 reveals evidence for subfunctionalization. Tripsianes, K., Folkers, G.E., Zheng, C. et al. Nucleic Acids Res (2007) 35:5789-5798. DOI 10.1093/nar/gkm503 · PubMed

Other PDB entries of the same protein (UniProt P07992 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A1I 1.9 Å, Crystal Structure of the Central Domain of Human ERCC1
2A1J 2.7 Å, Crystal Structure of the Complex between the C-Terminal Domains of Human XPF and ERCC1
9QEC 2.9 Å, Cryo-EM structure of the XPF-ERCC1-XPA complex
9QED 3.2 Å, Cryo-EM structure of the XPF-ERCC1-SLX4(330-555)-SLX4IP complex
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
9QEE 3.4 Å, Cryo-EM structure of a DNA-bound XPF-ERCC1-SLX4(330-555)-SLX4IP complex
6SXA 3.6 Å, XPF-ERCC1 Cryo-EM Structure, Apo-form
9PCP 4.3 Å, NER dual incision complex - NoG
6SXB 7.9 Å, XPF-ERCC1 Cryo-EM Structure, DNA-Bound form
1Z00 Solution structure of the C-terminal domain of ERCC1 complexed with the C-terminal…
2JNW Solution structure of a ERCC1-XPA heterodimer

Browse structure collections

About this viewer

MolViewer shows 2JPD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.