1Z00: C-terminal domain of ERCC1

Solution structure of the C-terminal domain of ERCC1 complexed with the C-terminal domain of XPF. Determined by solution NMR. Released 20 Dec 2005.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,296
Mol. weight: 19.23 kDa
Released: 20 Dec 2005

Explore 1Z00 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1Z00 contains 12 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	224-239	16
α-helix	247-256	10
β-strand	259	1	1
α-helix	260-265	6
α-helix	268-272	5
α-helix	279-290	12

Chain B: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	828-831	4
α-helix	835-842	8
α-helix	849-858	10
α-helix	862-867	6
α-helix	870-877	8
α-helix	880-890	11
β-strand	893	1	1
α-helix	894-897	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA excision repair protein ERCC-1	A	protein	89	Homo sapiens	P07992 (AlphaFold model)
DNA repair endonuclease XPF	B	protein	84	Homo sapiens	Q92889 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1Z00_1 DNA excision repair protein ERCC-1 (chains A)
MADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLG
PQKARRLFDVLHEPFLKVPGGLEHHHHHH

Sequence of entity 2 (B), FASTA

>1Z00_2 DNA repair endonuclease XPF (chains B)
MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAA
NAKQLYDFIHTSFAEVVSKGKGKK

Primary citation

The Structure of the Human ERCC1/XPF Interaction Domains Reveals a Complementary Role for the Two Proteins in Nucleotide Excision Repair. Tripsianes, K., Folkers, G., Ab, E. et al. Structure (2005) 13:1849-1858. DOI 10.1016/j.str.2005.08.014 · PubMed

Other PDB entries of the same protein (UniProt P07992 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A1I 1.9 Å, Crystal Structure of the Central Domain of Human ERCC1
2A1J 2.7 Å, Crystal Structure of the Complex between the C-Terminal Domains of Human XPF and ERCC1
9QEC 2.9 Å, Cryo-EM structure of the XPF-ERCC1-XPA complex
9QED 3.2 Å, Cryo-EM structure of the XPF-ERCC1-SLX4(330-555)-SLX4IP complex
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
9QEE 3.4 Å, Cryo-EM structure of a DNA-bound XPF-ERCC1-SLX4(330-555)-SLX4IP complex
6SXA 3.6 Å, XPF-ERCC1 Cryo-EM Structure, Apo-form
9PCP 4.3 Å, NER dual incision complex - NoG
6SXB 7.9 Å, XPF-ERCC1 Cryo-EM Structure, DNA-Bound form
2JNW Solution structure of a ERCC1-XPA heterodimer
2JPD Solution structure of the ERCC1 central domain

Browse structure collections

About this viewer

MolViewer shows 1Z00 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.