2A1J: DNA repair endonuclease XPF

Crystal Structure of the Complex between the C-Terminal Domains of Human XPF and ERCC1. Determined by X-ray diffraction at 2.7 Å resolution. Released 2 Aug 2005.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,094
Mol. weight: 17.37 kDa
Ligands: HG
Released: 2 Aug 2005

Explore 2A1J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2A1J contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	839-842	4
α-helix	849-858	10
α-helix	862-866	5
α-helix	870-877	8
α-helix	880-891	12

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	221-239	19
α-helix	247-257	11
α-helix	260-264	5
α-helix	268-272	5
α-helix	280-290	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair endonuclease XPF	A	protein	63	Homo sapiens	Q92889 (AlphaFold model)
DNA excision repair protein ERCC-1	B	protein	91	Homo sapiens	P07992 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2A1J_1 DNA repair endonuclease XPF (chains A)
MPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFA
EVV

Sequence of entity 2 (B), FASTA

>2A1J_2 DNA excision repair protein ERCC-1 (chains B)
MGSSHHHHHHSQDPADLLMEKLEQDFVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIA
ASREDLALCPGLGPQKARRLFDVLHEPFLKV

Ligands and cofactors

ID	Name	Formula	Copies
HG	Mercury (II) ion	Hg	1

Primary citation

Crystal structure and DNA binding functions of ERCC1, a subunit of the DNA structure-specific endonuclease XPF-ERCC1. Tsodikov, O.V., Enzlin, J.H., Scharer, O.D. et al. Proc Natl Acad Sci U S A (2005) 102:11236-11241. DOI 10.1073/pnas.0504341102 · PubMed

Other PDB entries of the same protein (UniProt Q92889 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QEC 2.9 Å, Cryo-EM structure of the XPF-ERCC1-XPA complex
9QED 3.2 Å, Cryo-EM structure of the XPF-ERCC1-SLX4(330-555)-SLX4IP complex
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
9QEE 3.4 Å, Cryo-EM structure of a DNA-bound XPF-ERCC1-SLX4(330-555)-SLX4IP complex
6SXA 3.6 Å, XPF-ERCC1 Cryo-EM Structure, Apo-form
9PCP 4.3 Å, NER dual incision complex - NoG
6SXB 7.9 Å, XPF-ERCC1 Cryo-EM Structure, DNA-Bound form
1Z00 Solution structure of the C-terminal domain of ERCC1 complexed with the C-terminal…
2AQ0 Solution structure of the human homodimeric dna repair protein XPF
2KN7 Structure of the XPF-single strand DNA complex
2MUT Solution structure of the F231L mutant ERCC1-XPF dimerization region

Browse structure collections

About this viewer

MolViewer shows 2A1J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.