2JNW: ERCC1-XPA heterodimer

Solution structure of a ERCC1-XPA heterodimer. Determined by solution NMR. Released 30 Oct 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,010
Mol. weight: 16.64 kDa
Released: 30 Oct 2007

Explore 2JNW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JNW contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	101-103	3	1
α-helix	105-107	3
α-helix	112-115	4
β-strand	121-123	3	1
β-strand	130-133	4	1
β-strand	136-141	6	1
α-helix	144-147	4
α-helix	152-160	9
β-strand	166-172	7	1
α-helix	179-192	14
β-strand	195-199	5	1
α-helix	202-213	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA excision repair protein ERCC-1	A	protein	133	Homo sapiens	P07992 (AlphaFold model)
DNA-repair protein complementing XP-A cells	B	protein	14		P23025 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JNW_1 DNA excision repair protein ERCC-1 (chains A)
MGSSHHHHHHSQDPAKSNSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFL
SLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQALKELAKMCILADCTLILAWS
PEEAGRYLETYKA

Sequence of entity 2 (B), FASTA

>2JNW_2 DNA-repair protein complementing XP-A cells (chains B)
KIIDTGGGFILEEE

Primary citation

Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA. Tsodikov, O.V., Ivanov, D., Orelli, B. et al. EMBO J (2007) 26:4768-4776. DOI 10.1038/sj.emboj.7601894 · PubMed

Other PDB entries of the same protein (UniProt P07992 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A1I 1.9 Å, Crystal Structure of the Central Domain of Human ERCC1
2A1J 2.7 Å, Crystal Structure of the Complex between the C-Terminal Domains of Human XPF and ERCC1
9QEC 2.9 Å, Cryo-EM structure of the XPF-ERCC1-XPA complex
9QED 3.2 Å, Cryo-EM structure of the XPF-ERCC1-SLX4(330-555)-SLX4IP complex
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
9QEE 3.4 Å, Cryo-EM structure of a DNA-bound XPF-ERCC1-SLX4(330-555)-SLX4IP complex
6SXA 3.6 Å, XPF-ERCC1 Cryo-EM Structure, Apo-form
9PCP 4.3 Å, NER dual incision complex - NoG
6SXB 7.9 Å, XPF-ERCC1 Cryo-EM Structure, DNA-Bound form
1Z00 Solution structure of the C-terminal domain of ERCC1 complexed with the C-terminal…
2JPD Solution structure of the ERCC1 central domain

Browse structure collections

About this viewer

MolViewer shows 2JNW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.