2AQ0: Human homodimeric dna repair protein XPF

Solution structure of the human homodimeric dna repair protein XPF. Determined by solution NMR. Released 3 Oct 2006.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,292
Mol. weight: 18.46 kDa
Released: 3 Oct 2006

Explore 2AQ0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2AQ0 contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	16-21	6
α-helix	28-37	10
α-helix	41-46	6
α-helix	49-56	8
α-helix	59-70	12

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	114-121	8
α-helix	128-137	10
α-helix	141-146	6
α-helix	149-156	8
α-helix	159-169	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair endonuclease XPF	A, B	protein	84	Homo sapiens	Q92889 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2AQ0_1 DNA repair endonuclease XPF (chains A, B)
MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAA
NAKQLYDFIHTSFAEVVSKGKGKK

Primary citation

The HhH domain of the human DNA repair protein XPF forms stable homodimers. Das, D., Tripsianes, K., Jaspers, N.G. et al. Proteins (2008) 70:1551-1563. DOI 10.1002/prot.21635 · PubMed

Other PDB entries of the same protein (UniProt Q92889 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A1J 2.7 Å, Crystal Structure of the Complex between the C-Terminal Domains of Human XPF and ERCC1
9QEC 2.9 Å, Cryo-EM structure of the XPF-ERCC1-XPA complex
9QED 3.2 Å, Cryo-EM structure of the XPF-ERCC1-SLX4(330-555)-SLX4IP complex
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
9QEE 3.4 Å, Cryo-EM structure of a DNA-bound XPF-ERCC1-SLX4(330-555)-SLX4IP complex
6SXA 3.6 Å, XPF-ERCC1 Cryo-EM Structure, Apo-form
9PCP 4.3 Å, NER dual incision complex - NoG
6SXB 7.9 Å, XPF-ERCC1 Cryo-EM Structure, DNA-Bound form
1Z00 Solution structure of the C-terminal domain of ERCC1 complexed with the C-terminal…
2KN7 Structure of the XPF-single strand DNA complex
2MUT Solution structure of the F231L mutant ERCC1-XPF dimerization region

Browse structure collections

About this viewer

MolViewer shows 2AQ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.