2KN7: XPF-single strand DNA complex

Structure of the XPF-single strand DNA complex. Determined by solution NMR. Released 4 Aug 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 4
Atoms: 1,452
Mol. weight: 21.02 kDa
Released: 4 Aug 2010

Explore 2KN7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KN7 contains 10 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	12	1	1
α-helix	16-21	6
α-helix	28-37	10
α-helix	41-46	6
α-helix	49-56	8
α-helix	59-69	11

Chain D: 5 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	116-121	6
α-helix	128-137	10
α-helix	141-146	6
α-helix	149-156	8
α-helix	159-169	11
β-strand	174	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair endonuclease XPF	A, D	protein	67	Homo sapiens	Q92889 (AlphaFold model)
DNA (5'-d(cpapgptpgpgpcptpgpa)-3')	B, C	DNA	10

Sequence of entity 1 (A, D), FASTA

>2KN7_1 DNA repair endonuclease XPF (chains A, D)
EKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFI
HTSFAEV

Sequence of entity 2 (B, C), FASTA

>2KN7_2 DNA (5'-D(*CP*AP*GP*TP*GP*GP*CP*TP*GP*A)-3') (chains B, C)
CAGTGGCTGA

Primary citation

The structure of the XPF-ssDNA complex underscores the distinct roles of the XPF and ERCC1 helix- hairpin-helix domains in ss/ds DNA recognition. Das, D., Folkers, G.E., van Dijk, M. et al. Structure (2012) 20:667-675. DOI 10.1016/j.str.2012.02.009 · PubMed

Other PDB entries of the same protein (UniProt Q92889 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A1J 2.7 Å, Crystal Structure of the Complex between the C-Terminal Domains of Human XPF and ERCC1
9QEC 2.9 Å, Cryo-EM structure of the XPF-ERCC1-XPA complex
9QED 3.2 Å, Cryo-EM structure of the XPF-ERCC1-SLX4(330-555)-SLX4IP complex
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
9QEE 3.4 Å, Cryo-EM structure of a DNA-bound XPF-ERCC1-SLX4(330-555)-SLX4IP complex
6SXA 3.6 Å, XPF-ERCC1 Cryo-EM Structure, Apo-form
9PCP 4.3 Å, NER dual incision complex - NoG
6SXB 7.9 Å, XPF-ERCC1 Cryo-EM Structure, DNA-Bound form
1Z00 Solution structure of the C-terminal domain of ERCC1 complexed with the C-terminal…
2AQ0 Solution structure of the human homodimeric dna repair protein XPF
2MUT Solution structure of the F231L mutant ERCC1-XPF dimerization region

Browse structure collections

About this viewer

MolViewer shows 2KN7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.