2MUT: F231L mutant ERCC1-XPF dimerization region

Solution structure of the F231L mutant ERCC1-XPF dimerization region. Determined by solution NMR. Released 24 Jun 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,415
Mol. weight: 20.22 kDa
Released: 24 Jun 2015

Explore 2MUT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MUT contains 12 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	219-240	22
α-helix	247-256	10
β-strand	259	1	1
α-helix	260-264	5
α-helix	268-273	6
α-helix	279-290	12
β-strand	299	1	2
β-strand	303	1	2

Chain B: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	829-831	3
α-helix	835-842	8
α-helix	849-858	10
α-helix	862-867	6
α-helix	870-877	8
α-helix	880-890	11
β-strand	893	1	1
α-helix	894-898	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA excision repair protein ERCC-1	A	protein	96	Homo sapiens	P07992 (AlphaFold model)
DNA repair endonuclease XPF	B	protein	84	Homo sapiens	Q92889 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MUT_1 DNA excision repair protein ERCC-1 (chains A)
RIRRRYNMADLLMEKLEQDLVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDL
ALCPGLGPQKARRLFDVLHEPFLKVPGGLEHHHHHH

Sequence of entity 2 (B), FASTA

>2MUT_2 DNA repair endonuclease XPF (chains B)
MDSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAA
NAKQLYDFIHTSFAEVVSKGKGKK

Primary citation

The Cerebro-oculo-facio-skeletal Syndrome Point Mutation F231L in the ERCC1 DNA Repair Protein Causes Dissociation of the ERCC1-XPF Complex. Faridounnia, M., Wienk, H., Kovacic, L. et al. J Biol Chem (2015) 290:20541-20555. DOI 10.1074/jbc.M114.635169 · PubMed

Other PDB entries of the same protein (UniProt P07992 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A1I 1.9 Å, Crystal Structure of the Central Domain of Human ERCC1
2A1J 2.7 Å, Crystal Structure of the Complex between the C-Terminal Domains of Human XPF and ERCC1
9QEC 2.9 Å, Cryo-EM structure of the XPF-ERCC1-XPA complex
9QED 3.2 Å, Cryo-EM structure of the XPF-ERCC1-SLX4(330-555)-SLX4IP complex
9PD3 3.3 Å, NER dual incision complex - DuIS
9PD4 3.4 Å, NER dual incision complex - DuIM
9QEE 3.4 Å, Cryo-EM structure of a DNA-bound XPF-ERCC1-SLX4(330-555)-SLX4IP complex
6SXA 3.6 Å, XPF-ERCC1 Cryo-EM Structure, Apo-form
9PCP 4.3 Å, NER dual incision complex - NoG
6SXB 7.9 Å, XPF-ERCC1 Cryo-EM Structure, DNA-Bound form
1Z00 Solution structure of the C-terminal domain of ERCC1 complexed with the C-terminal…
2JNW Solution structure of a ERCC1-XPA heterodimer

Browse structure collections

About this viewer

MolViewer shows 2MUT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.